Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc(toxin) |
Location | 2485992..2486551 | Replicon | chromosome |
Accession | NZ_CP104755 | ||
Organism | Shewanella putrefaciens strain 4H |
Toxin (Protein)
Gene name | doc | Uniprot ID | - |
Locus tag | N5094_RS10945 | Protein ID | WP_172591132.1 |
Coordinates | 2485992..2486381 (-) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | - |
Locus tag | N5094_RS10950 | Protein ID | WP_172591131.1 |
Coordinates | 2486381..2486551 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5094_RS10935 (N5094_10935) | 2482680..2483003 | + | 324 | WP_261761631.1 | helix-turn-helix domain-containing protein | - |
N5094_RS10940 (N5094_10940) | 2483150..2485867 | + | 2718 | WP_261761632.1 | phage/plasmid primase, P4 family | - |
N5094_RS10945 (N5094_10945) | 2485992..2486381 | - | 390 | WP_172591132.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
N5094_RS10950 (N5094_10950) | 2486381..2486551 | - | 171 | WP_172591131.1 | acetyltransferase | Antitoxin |
N5094_RS10955 (N5094_10955) | 2486677..2488494 | - | 1818 | WP_261761633.1 | site-specific integrase | - |
N5094_RS10965 (N5094_10965) | 2488934..2490928 | - | 1995 | WP_011919219.1 | nitrate- and nitrite sensing domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 14212.28 Da Isoelectric Point: 3.9777
>T259107 WP_172591132.1 NZ_CP104755:c2486381-2485992 [Shewanella putrefaciens]
MDIICFPFERVVEINALILSTEPGMKGAVDIPKLQGALSRIDNAIVYQGLDDVFEIAAKYTACIAVSHACPDANKRTGLA
VALEYLSLNDYEITEDNELLANAIRDLVLQEITETDFADILYAQYLKGL
MDIICFPFERVVEINALILSTEPGMKGAVDIPKLQGALSRIDNAIVYQGLDDVFEIAAKYTACIAVSHACPDANKRTGLA
VALEYLSLNDYEITEDNELLANAIRDLVLQEITETDFADILYAQYLKGL
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|