Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/- |
| Location | 1570959..1571551 | Replicon | chromosome |
| Accession | NZ_CP104755 | ||
| Organism | Shewanella putrefaciens strain 4H | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A252ENI2 |
| Locus tag | N5094_RS06925 | Protein ID | WP_014610888.1 |
| Coordinates | 1571297..1571551 (-) | Length | 85 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A252ENK1 |
| Locus tag | N5094_RS06920 | Protein ID | WP_014610929.1 |
| Coordinates | 1570959..1571300 (-) | Length | 114 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5094_RS06895 (N5094_06895) | 1567730..1567822 | - | 93 | Protein_1330 | transposase family protein | - |
| N5094_RS06900 (N5094_06900) | 1568134..1568379 | + | 246 | WP_014610893.1 | type II toxin-antitoxin system CcdA family antitoxin | - |
| N5094_RS06905 (N5094_06905) | 1568379..1568696 | + | 318 | WP_014610892.1 | CcdB family protein | - |
| N5094_RS06910 (N5094_06910) | 1569051..1570418 | + | 1368 | WP_014610930.1 | HipA domain-containing protein | - |
| N5094_RS06915 (N5094_06915) | 1570415..1570795 | + | 381 | WP_086904820.1 | helix-turn-helix transcriptional regulator | - |
| N5094_RS06920 (N5094_06920) | 1570959..1571300 | - | 342 | WP_014610929.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| N5094_RS06925 (N5094_06925) | 1571297..1571551 | - | 255 | WP_014610888.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| N5094_RS06930 (N5094_06930) | 1571948..1572559 | - | 612 | WP_115014218.1 | mobile mystery protein B | - |
| N5094_RS06935 (N5094_06935) | 1572556..1573044 | - | 489 | WP_069453178.1 | mobile mystery protein A | - |
| N5094_RS06940 (N5094_06940) | 1573249..1573631 | + | 383 | Protein_1339 | transposase | - |
| N5094_RS06945 (N5094_06945) | 1574187..1575200 | + | 1014 | WP_069453176.1 | dTDP-glucose 4,6-dehydratase | - |
| N5094_RS06950 (N5094_06950) | 1575266..1575447 | + | 182 | Protein_1341 | tyrosine-type recombinase/integrase | - |
| N5094_RS06955 (N5094_06955) | 1575526..1575690 | - | 165 | WP_014610884.1 | hypothetical protein | - |
| N5094_RS06960 (N5094_06960) | 1575712..1576437 | - | 726 | WP_220777342.1 | zeta toxin family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 1573177..1573611 | 434 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 85 a.a. Molecular weight: 9480.99 Da Isoelectric Point: 10.1453
>T259106 WP_014610888.1 NZ_CP104755:c1571551-1571297 [Shewanella putrefaciens]
MNKKHLRTLTAIFARPVSGAIKWSDIEALFIALGADIEEREGSRIGVVLFGEVQVYHRPHPQKETDKDAVISIKKWLERN
GVKA
MNKKHLRTLTAIFARPVSGAIKWSDIEALFIALGADIEEREGSRIGVVLFGEVQVYHRPHPQKETDKDAVISIKKWLERN
GVKA
Download Length: 255 bp
Antitoxin
Download Length: 114 a.a. Molecular weight: 12379.91 Da Isoelectric Point: 4.3992
>AT259106 WP_014610929.1 NZ_CP104755:c1571300-1570959 [Shewanella putrefaciens]
MKNLMMINGVKAFIDYDPDAETFRGEFVGLNGGADFYGESVAQLEAEGAKSLSVFLEMCQERGIEPYKNFSGKFNVRISP
EVHARLNEIALSQSISLNAAVENAVNDYIAHSA
MKNLMMINGVKAFIDYDPDAETFRGEFVGLNGGADFYGESVAQLEAEGAKSLSVFLEMCQERGIEPYKNFSGKFNVRISP
EVHARLNEIALSQSISLNAAVENAVNDYIAHSA
Download Length: 342 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A252ENI2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A252ENK1 |