Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | VII | Classification (family/domain) | HepT-MntA/HepT(toxin) |
Location | 1546818..1547649 | Replicon | chromosome |
Accession | NZ_CP104755 | ||
Organism | Shewanella putrefaciens strain 4H |
Toxin (Protein)
Gene name | hepT | Uniprot ID | - |
Locus tag | N5094_RS06765 | Protein ID | WP_088585313.1 |
Coordinates | 1546818..1547234 (-) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | mntA | Uniprot ID | - |
Locus tag | N5094_RS06770 | Protein ID | WP_088585314.1 |
Coordinates | 1547227..1547649 (-) | Length | 141 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5094_RS06730 (N5094_06730) | 1541877..1543487 | - | 1611 | WP_011787758.1 | IS1634-like element ISSpu7 family transposase | - |
N5094_RS06735 (N5094_06735) | 1543695..1544039 | - | 345 | WP_261762689.1 | IS66 family insertion sequence element accessory protein TnpB | - |
N5094_RS06740 (N5094_06740) | 1544036..1544335 | - | 300 | WP_088585869.1 | hypothetical protein | - |
N5094_RS06745 (N5094_06745) | 1544465..1545817 | + | 1353 | WP_261762690.1 | phosphoglucosamine mutase | - |
N5094_RS06750 (N5094_06750) | 1546027..1546170 | - | 144 | WP_261762691.1 | hypothetical protein | - |
N5094_RS06755 (N5094_06755) | 1546233..1546472 | + | 240 | WP_014610939.1 | CopG family ribbon-helix-helix protein | - |
N5094_RS06760 (N5094_06760) | 1546462..1546746 | + | 285 | WP_261762692.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
N5094_RS06765 (N5094_06765) | 1546818..1547234 | - | 417 | WP_088585313.1 | DUF86 domain-containing protein | Toxin |
N5094_RS06770 (N5094_06770) | 1547227..1547649 | - | 423 | WP_088585314.1 | nucleotidyltransferase domain-containing protein | Antitoxin |
N5094_RS06775 (N5094_06775) | 1548152..1548412 | + | 261 | WP_086904670.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
N5094_RS06780 (N5094_06780) | 1548414..1548761 | + | 348 | WP_055647497.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
N5094_RS06785 (N5094_06785) | 1548973..1550181 | + | 1209 | WP_261762693.1 | molecular chaperone DnaJ | - |
N5094_RS06790 (N5094_06790) | 1550975..1551391 | - | 417 | WP_261762694.1 | type II toxin-antitoxin system YafO family toxin | - |
N5094_RS06795 (N5094_06795) | 1551382..1551699 | - | 318 | WP_261762695.1 | antitoxin of toxin-antitoxin stability system | - |
N5094_RS06800 (N5094_06800) | 1551808..1551987 | + | 180 | Protein_1311 | IS66 family transposase | - |
N5094_RS06805 (N5094_06805) | 1552360..1552566 | - | 207 | Protein_1312 | integrase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 16056.55 Da Isoelectric Point: 7.3244
>T259105 WP_088585313.1 NZ_CP104755:c1547234-1546818 [Shewanella putrefaciens]
MNDIIINKIATIKRCIKRIQQVYGDGSMFKQDFTLQDSVILNLQRCCEASIDIANHINRQQQLGIPQSSRDSFTLLSQNK
IINQQLADNLKKMVGLRNIAVHDYQELNLDIVVHVVQHHLEDFEQFIEVIKFCPRMSY
MNDIIINKIATIKRCIKRIQQVYGDGSMFKQDFTLQDSVILNLQRCCEASIDIANHINRQQQLGIPQSSRDSFTLLSQNK
IINQQLADNLKKMVGLRNIAVHDYQELNLDIVVHVVQHHLEDFEQFIEVIKFCPRMSY
Download Length: 417 bp
Antitoxin
Download Length: 141 a.a. Molecular weight: 15861.89 Da Isoelectric Point: 5.1231
>AT259105 WP_088585314.1 NZ_CP104755:c1547649-1547227 [Shewanella putrefaciens]
MQQLNESIIINLLQDNIPQLRLIYLFGSYAQGTQHRNSDIDIAVLADVTLDNIARWQLAQKLASALDTDVDLVDLRTAST
VLCQQVVTQGKRLWGTRQDDEIFAVKTISMYQHLQAERQAIIDDATAKTTANDHRGRHFE
MQQLNESIIINLLQDNIPQLRLIYLFGSYAQGTQHRNSDIDIAVLADVTLDNIARWQLAQKLASALDTDVDLVDLRTAST
VLCQQVVTQGKRLWGTRQDDEIFAVKTISMYQHLQAERQAIIDDATAKTTANDHRGRHFE
Download Length: 423 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|