Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/PRK09907-MazE |
Location | 1736..2337 | Replicon | plasmid pMGEL21054 |
Accession | NZ_CP104754 | ||
Organism | Lactiplantibacillus plantarum strain MGEL20154 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | Q684P1 |
Locus tag | N5101_RS15450 | Protein ID | WP_001748110.1 |
Coordinates | 1736..2080 (-) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | Q684P2 |
Locus tag | N5101_RS15455 | Protein ID | WP_003643337.1 |
Coordinates | 2074..2337 (-) | Length | 88 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5101_RS15440 | 17..385 | - | 369 | WP_003643339.1 | hypothetical protein | - |
N5101_RS15445 | 485..1414 | - | 930 | Protein_1 | IS30 family transposase | - |
N5101_RS15450 | 1736..2080 | - | 345 | WP_001748110.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
N5101_RS15455 | 2074..2337 | - | 264 | WP_003643337.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
N5101_RS15460 | 2423..3010 | + | 588 | WP_010625610.1 | site-specific integrase | - |
N5101_RS15465 | 5418..5942 | - | 525 | WP_003646143.1 | hypothetical protein | - |
N5101_RS15470 | 6586..6828 | - | 243 | WP_003643341.1 | hypothetical protein | - |
N5101_RS15475 | 6915..7115 | - | 201 | WP_003643340.1 | cold-shock protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..7221 | 7221 | |
- | flank | IS/Tn | - | - | 641..1414 | 773 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13041.89 Da Isoelectric Point: 6.4782
>T259104 WP_001748110.1 NZ_CP104754:c2080-1736 [Lactiplantibacillus plantarum]
MVSQGDIFYVNFNPSRGHEQMNKRPAIALSNDLVCQTSNMTIVAPISSTKRNFPMYHRLTSSQTVYGKVLLDQTIALDLR
ARHVTDETIVDHVSREELEEIITLYKLLFSIDDK
MVSQGDIFYVNFNPSRGHEQMNKRPAIALSNDLVCQTSNMTIVAPISSTKRNFPMYHRLTSSQTVYGKVLLDQTIALDLR
ARHVTDETIVDHVSREELEEIITLYKLLFSIDDK
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0R2K1X3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6L4ZZT2 |