Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/- |
Location | 448216..448869 | Replicon | chromosome |
Accession | NZ_CP104751 | ||
Organism | Acinetobacter baumannii strain 37662 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | N6Q85_RS02185 | Protein ID | WP_000607077.1 |
Coordinates | 448480..448869 (+) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | V5V966 |
Locus tag | N6Q85_RS02180 | Protein ID | WP_001288210.1 |
Coordinates | 448216..448473 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N6Q85_RS02160 (N6Q85_02160) | 443732..444739 | + | 1008 | WP_000198631.1 | DNA-directed RNA polymerase subunit alpha | - |
N6Q85_RS02165 (N6Q85_02165) | 444758..445135 | + | 378 | WP_001216380.1 | 50S ribosomal protein L17 | - |
N6Q85_RS02170 (N6Q85_02170) | 445317..446807 | + | 1491 | WP_000415125.1 | NAD(P)/FAD-dependent oxidoreductase | - |
N6Q85_RS02175 (N6Q85_02175) | 446856..448028 | - | 1173 | WP_001190542.1 | acyl-CoA dehydrogenase family protein | - |
N6Q85_RS02180 (N6Q85_02180) | 448216..448473 | + | 258 | WP_001288210.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
N6Q85_RS02185 (N6Q85_02185) | 448480..448869 | + | 390 | WP_000607077.1 | membrane protein | Toxin |
N6Q85_RS02190 (N6Q85_02190) | 449639..450724 | + | 1086 | WP_261503124.1 | hypothetical protein | - |
N6Q85_RS02195 (N6Q85_02195) | 450802..451368 | + | 567 | WP_000651538.1 | rhombosortase | - |
N6Q85_RS02200 (N6Q85_02200) | 451556..453751 | + | 2196 | WP_001158906.1 | TRAP transporter large permease subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 15552.88 Da Isoelectric Point: 10.4313
>T259103 WP_000607077.1 NZ_CP104751:448480-448869 [Acinetobacter baumannii]
MINHLNFKLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYKSQNTV
SRVKILKIIDCQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLY
MINHLNFKLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYKSQNTV
SRVKILKIIDCQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLY
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|