Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-Xre |
Location | 19827..20544 | Replicon | plasmid unnamed1 |
Accession | NZ_CP104746 | ||
Organism | Erwinia pyrifoliae strain CP20113301 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | NYP80_RS19360 | Protein ID | WP_261648169.1 |
Coordinates | 19827..20234 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | NYP80_RS19365 | Protein ID | WP_261648134.1 |
Coordinates | 20227..20544 (+) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYP80_RS19315 (NYP80_19315) | 15425..15901 | + | 477 | WP_261648160.1 | hypothetical protein | - |
NYP80_RS19320 (NYP80_19320) | 15990..16403 | - | 414 | WP_261648161.1 | relaxosome protein TraM | - |
NYP80_RS19325 (NYP80_19325) | 16902..17036 | - | 135 | WP_261648162.1 | hypothetical protein | - |
NYP80_RS19330 (NYP80_19330) | 17104..17298 | - | 195 | WP_261648163.1 | hypothetical protein | - |
NYP80_RS19335 (NYP80_19335) | 17350..17679 | - | 330 | WP_261648164.1 | hypothetical protein | - |
NYP80_RS19340 (NYP80_19340) | 17777..17995 | - | 219 | WP_261648165.1 | hypothetical protein | - |
NYP80_RS19345 (NYP80_19345) | 17988..18254 | - | 267 | WP_261648166.1 | hypothetical protein | - |
NYP80_RS19350 (NYP80_19350) | 18266..18808 | - | 543 | WP_261648167.1 | hypothetical protein | - |
NYP80_RS19355 (NYP80_19355) | 18852..19367 | - | 516 | WP_261648168.1 | DnaJ domain-containing protein | - |
NYP80_RS19360 (NYP80_19360) | 19827..20234 | + | 408 | WP_261648169.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NYP80_RS19365 (NYP80_19365) | 20227..20544 | + | 318 | WP_261648134.1 | helix-turn-helix domain-containing protein | Antitoxin |
NYP80_RS19370 (NYP80_19370) | 20949..21932 | + | 984 | WP_261648135.1 | recombinase family protein | - |
NYP80_RS19375 (NYP80_19375) | 21955..22290 | - | 336 | WP_044242374.1 | hypothetical protein | - |
NYP80_RS19380 (NYP80_19380) | 22287..22994 | - | 708 | WP_261648136.1 | ParA family protein | - |
NYP80_RS19385 (NYP80_19385) | 24162..25025 | - | 864 | WP_191928390.1 | incFII family plasmid replication initiator RepA | - |
NYP80_RS19390 (NYP80_19390) | 25018..25092 | - | 75 | WP_261648170.1 | RepA leader peptide Tap | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..40042 | 40042 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 14973.22 Da Isoelectric Point: 5.2929
>T259100 WP_261648169.1 NZ_CP104746:19827-20234 [Erwinia pyrifoliae]
MDALSVMGIYLTSEFETERQKARISNAMLRKAAKAIFSGLPGDPLGKFTFKKRLGLPGVGARDGARSIVFFNDGDNIFFF
DMYLKSGLSKKKGKELEDDEIDAYCNIAKDFISMSPATINKLLSDKELVEVNCDD
MDALSVMGIYLTSEFETERQKARISNAMLRKAAKAIFSGLPGDPLGKFTFKKRLGLPGVGARDGARSIVFFNDGDNIFFF
DMYLKSGLSKKKGKELEDDEIDAYCNIAKDFISMSPATINKLLSDKELVEVNCDD
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|