Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/- |
Location | 1570862..1571493 | Replicon | chromosome |
Accession | NZ_CP104745 | ||
Organism | Erwinia pyrifoliae strain CP20113301 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | NYP80_RS07650 | Protein ID | WP_259818053.1 |
Coordinates | 1570862..1571137 (+) | Length | 92 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | NYP80_RS07655 | Protein ID | WP_259818054.1 |
Coordinates | 1571134..1571493 (+) | Length | 120 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYP80_RS07620 (NYP80_07620) | 1565986..1566342 | + | 357 | WP_259818045.1 | hypothetical protein | - |
NYP80_RS07625 (NYP80_07625) | 1566384..1566935 | + | 552 | WP_259818046.1 | hypothetical protein | - |
NYP80_RS07630 (NYP80_07630) | 1567009..1567236 | + | 228 | WP_259818047.1 | DUF2732 domain-containing protein | - |
NYP80_RS07635 (NYP80_07635) | 1567236..1567463 | + | 228 | WP_259819510.1 | TraR/DksA family transcriptional regulator | - |
NYP80_RS07640 (NYP80_07640) | 1567460..1568266 | + | 807 | WP_259818050.1 | DNA adenine methylase | - |
NYP80_RS07645 (NYP80_07645) | 1568482..1570791 | + | 2310 | WP_261648096.1 | replication endonuclease | - |
NYP80_RS07650 (NYP80_07650) | 1570862..1571137 | + | 276 | WP_259818053.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
NYP80_RS07655 (NYP80_07655) | 1571134..1571493 | + | 360 | WP_259818054.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
NYP80_RS07660 (NYP80_07660) | 1571773..1571988 | + | 216 | WP_259818056.1 | hypothetical protein | - |
NYP80_RS07665 (NYP80_07665) | 1572207..1572800 | + | 594 | WP_259819513.1 | hypothetical protein | - |
NYP80_RS07670 (NYP80_07670) | 1572812..1573192 | + | 381 | WP_259819514.1 | type II toxin-antitoxin system YafO family toxin | - |
NYP80_RS07675 (NYP80_07675) | 1573646..1574689 | - | 1044 | WP_259819516.1 | phage portal protein | - |
NYP80_RS07680 (NYP80_07680) | 1574689..1576416 | - | 1728 | WP_259825666.1 | terminase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1560976..1601428 | 40452 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10127.67 Da Isoelectric Point: 10.7783
>T259097 WP_259818053.1 NZ_CP104745:1570862-1571137 [Erwinia pyrifoliae]
MKERVSLLRKKQKSTLEQIFKSPVQSGIRWADVESLIKALGGEVKEGRGSRCKFLLNGSIANFHRPHPSPDTDKGAVANL
RDWLESTGVKP
MKERVSLLRKKQKSTLEQIFKSPVQSGIRWADVESLIKALGGEVKEGRGSRCKFLLNGSIANFHRPHPSPDTDKGAVANL
RDWLESTGVKP
Download Length: 276 bp
Antitoxin
Download Length: 120 a.a. Molecular weight: 13209.89 Da Isoelectric Point: 4.9001
>AT259097 WP_259818054.1 NZ_CP104745:1571134-1571493 [Erwinia pyrifoliae]
MSKTSTTNTIEIAGQPAVIVFVPELNAFRGKFLGLTGYCDFVSDSIQGLKNEGEISLREYLDDCSAAGIEPYARQEKIKT
FTLRYPESFGERLNQAAAGHETSVNTFIIETLNERMKHA
MSKTSTTNTIEIAGQPAVIVFVPELNAFRGKFLGLTGYCDFVSDSIQGLKNEGEISLREYLDDCSAAGIEPYARQEKIKT
FTLRYPESFGERLNQAAAGHETSVNTFIIETLNERMKHA
Download Length: 360 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|