Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1127569..1128197 | Replicon | chromosome |
Accession | NZ_CP104745 | ||
Organism | Erwinia pyrifoliae strain CP20113301 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | D2T444 |
Locus tag | NYP80_RS05370 | Protein ID | WP_004156337.1 |
Coordinates | 1127569..1127787 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | - |
Locus tag | NYP80_RS05375 | Protein ID | WP_012668861.1 |
Coordinates | 1127817..1128197 (-) | Length | 127 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYP80_RS05340 (NYP80_05340) | 1123553..1123891 | + | 339 | WP_012668866.1 | P-II family nitrogen regulator | - |
NYP80_RS05345 (NYP80_05345) | 1123914..1125215 | + | 1302 | WP_012668865.1 | ammonium transporter AmtB | - |
NYP80_RS05350 (NYP80_05350) | 1125290..1126150 | - | 861 | WP_012668864.1 | acyl-CoA thioesterase II | - |
NYP80_RS05355 (NYP80_05355) | 1126373..1126888 | + | 516 | WP_261648071.1 | YbaY family lipoprotein | - |
NYP80_RS05360 (NYP80_05360) | 1126953..1127270 | - | 318 | WP_012668862.1 | MGMT family protein | - |
NYP80_RS05370 (NYP80_05370) | 1127569..1127787 | - | 219 | WP_004156337.1 | HHA domain-containing protein | Toxin |
NYP80_RS05375 (NYP80_05375) | 1127817..1128197 | - | 381 | WP_012668861.1 | Hha toxicity modulator TomB | Antitoxin |
NYP80_RS05380 (NYP80_05380) | 1128344..1128697 | - | 354 | WP_012668860.1 | hypothetical protein | - |
NYP80_RS05385 (NYP80_05385) | 1129154..1129300 | - | 147 | WP_012668859.1 | type B 50S ribosomal protein L36 | - |
NYP80_RS05390 (NYP80_05390) | 1129311..1129571 | - | 261 | WP_012668858.1 | type B 50S ribosomal protein L31 | - |
NYP80_RS05395 (NYP80_05395) | 1129726..1132866 | - | 3141 | WP_012668857.1 | multidrug efflux RND transporter permease subunit AcrB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8627.06 Da Isoelectric Point: 8.9007
>T259096 WP_004156337.1 NZ_CP104745:c1127787-1127569 [Erwinia pyrifoliae]
MTDKLLTKTDYLMRLRRCRSIDTLERVIEKNKYELSDDELAVFYSAADHRLAELTMNKLYDKVPVAVWKFVR
MTDKLLTKTDYLMRLRRCRSIDTLERVIEKNKYELSDDELAVFYSAADHRLAELTMNKLYDKVPVAVWKFVR
Download Length: 219 bp
Antitoxin
Download Length: 127 a.a. Molecular weight: 14721.47 Da Isoelectric Point: 4.8834
>AT259096 WP_012668861.1 NZ_CP104745:c1128197-1127817 [Erwinia pyrifoliae]
MDEYSPKRHDIAQLKFLCENLYDESLATLGDSHHGWVNDPTSTSNLQLNDLIEHIAAFTMNYKIKHIEDCDLISQIDEYL
DDTFMLFSNYGVNTHDLQRWQKSAKRLFNIFAKECLMSQVQSSHSF
MDEYSPKRHDIAQLKFLCENLYDESLATLGDSHHGWVNDPTSTSNLQLNDLIEHIAAFTMNYKIKHIEDCDLISQIDEYL
DDTFMLFSNYGVNTHDLQRWQKSAKRLFNIFAKECLMSQVQSSHSF
Download Length: 381 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|