Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 767242..767902 | Replicon | chromosome |
Accession | NZ_CP104745 | ||
Organism | Erwinia pyrifoliae strain CP20113301 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | D2T6A5 |
Locus tag | NYP80_RS03695 | Protein ID | WP_014539414.1 |
Coordinates | 767489..767902 (+) | Length | 138 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | - |
Locus tag | NYP80_RS03690 | Protein ID | WP_012669171.1 |
Coordinates | 767242..767508 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYP80_RS03670 (NYP80_03670) | 764247..764456 | + | 210 | WP_259816865.1 | SDR family oxidoreductase | - |
NYP80_RS03675 (NYP80_03675) | 764550..765158 | - | 609 | WP_012669174.1 | HD domain-containing protein | - |
NYP80_RS03680 (NYP80_03680) | 765370..766029 | + | 660 | WP_012669173.1 | hemolysin III family protein | - |
NYP80_RS03685 (NYP80_03685) | 766030..767016 | - | 987 | WP_259826094.1 | tRNA-modifying protein YgfZ | - |
NYP80_RS03690 (NYP80_03690) | 767242..767508 | + | 267 | WP_012669171.1 | FAD assembly factor SdhE | Antitoxin |
NYP80_RS03695 (NYP80_03695) | 767489..767902 | + | 414 | WP_014539414.1 | protein YgfX | Toxin |
NYP80_RS03700 (NYP80_03700) | 768026..768544 | - | 519 | WP_012669169.1 | flavodoxin FldB | - |
NYP80_RS03705 (NYP80_03705) | 768590..769543 | - | 954 | WP_259826095.1 | DMT family transporter | - |
NYP80_RS03710 (NYP80_03710) | 769859..770752 | + | 894 | WP_014543356.1 | site-specific tyrosine recombinase XerD | - |
NYP80_RS03715 (NYP80_03715) | 770798..771502 | + | 705 | WP_012669166.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 16057.13 Da Isoelectric Point: 12.3470
>T259094 WP_014539414.1 NZ_CP104745:767489-767902 [Erwinia pyrifoliae]
VVLWQCELRQSKLAQRLSLLLHGAVMLALLLPAWPASAGLVRMLLLVLVLLECIRSRRRIRRRQGDVALLGGHALRWRQR
EWRILSRPWLTRQAILLSLRDAKGERERLWLFADGMADSHWRRLRMQLLNNKEQGNG
VVLWQCELRQSKLAQRLSLLLHGAVMLALLLPAWPASAGLVRMLLLVLVLLECIRSRRRIRRRQGDVALLGGHALRWRQR
EWRILSRPWLTRQAILLSLRDAKGERERLWLFADGMADSHWRRLRMQLLNNKEQGNG
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|