Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 4666894..4667429 | Replicon | chromosome |
Accession | NZ_CP104733 | ||
Organism | Pectobacterium sp. F1-1 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | NAL19_RS20985 | Protein ID | WP_263058353.1 |
Coordinates | 4667142..4667429 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | Q6DB37 |
Locus tag | NAL19_RS20980 | Protein ID | WP_010281712.1 |
Coordinates | 4666894..4667145 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NAL19_RS20955 (NAL19_4490) | 4662542..4663053 | - | 512 | Protein_4086 | phenolic acid decarboxylase | - |
NAL19_RS20960 (NAL19_4492) | 4663153..4664025 | + | 873 | WP_263058349.1 | LysR family transcriptional regulator | - |
NAL19_RS20965 (NAL19_4493) | 4664052..4664672 | - | 621 | WP_263058350.1 | LysE family translocator | - |
NAL19_RS20970 (NAL19_4494) | 4664941..4665696 | + | 756 | WP_263058351.1 | thiol:disulfide interchange protein DsbG | - |
NAL19_RS20975 (NAL19_4495) | 4665731..4666636 | - | 906 | WP_263058352.1 | siderophore-interacting protein | - |
NAL19_RS20980 (NAL19_4497) | 4666894..4667145 | + | 252 | WP_010281712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NAL19_RS20985 (NAL19_4498) | 4667142..4667429 | + | 288 | WP_263058353.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NAL19_RS20990 | 4667530..4668884 | - | 1355 | Protein_4093 | glutathione-disulfide reductase | - |
NAL19_RS20995 (NAL19_4502) | 4669013..4669855 | - | 843 | WP_180742117.1 | 23S rRNA (adenine(2030)-N(6))-methyltransferase RlmJ | - |
NAL19_RS21000 (NAL19_4503) | 4670074..4670802 | + | 729 | WP_263058354.1 | DUF1266 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11025.10 Da Isoelectric Point: 10.2271
>T259092 WP_263058353.1 NZ_CP104733:4667142-4667429 [Pectobacterium sp. F1-1]
MSYSVKFREDALKEWCKLDKTIQQQFAKKLKKCCENPHIPAAKLRGMKDCYKIKLRASGFRLVYEVIDDILVIAVVAVGK
RERSGVYNLASERMR
MSYSVKFREDALKEWCKLDKTIQQQFAKKLKKCCENPHIPAAKLRGMKDCYKIKLRASGFRLVYEVIDDILVIAVVAVGK
RERSGVYNLASERMR
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|