Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 3672215..3672740 | Replicon | chromosome |
Accession | NZ_CP104733 | ||
Organism | Pectobacterium sp. F1-1 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | NAL19_RS16415 | Protein ID | WP_039534786.1 |
Coordinates | 3672215..3672499 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | C6D956 |
Locus tag | NAL19_RS16420 | Protein ID | WP_005973616.1 |
Coordinates | 3672489..3672740 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NAL19_RS16395 (NAL19_3533) | 3668279..3669130 | - | 852 | WP_263057898.1 | TauD/TfdA family dioxygenase | - |
NAL19_RS16400 (NAL19_3534) | 3669185..3670141 | - | 957 | WP_263057899.1 | isocyanide synthase family protein | - |
NAL19_RS16405 | 3670389..3671197 | + | 809 | Protein_3202 | IS5 family transposase | - |
NAL19_RS16410 | 3671236..3671900 | + | 665 | Protein_3203 | transposase | - |
NAL19_RS16415 (NAL19_3539) | 3672215..3672499 | - | 285 | WP_039534786.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NAL19_RS16420 (NAL19_3540) | 3672489..3672740 | - | 252 | WP_005973616.1 | prevent-host-death protein | Antitoxin |
NAL19_RS16425 (NAL19_3541) | 3673333..3675132 | + | 1800 | WP_263057900.1 | AIPR family protein | - |
NAL19_RS16430 | 3675238..3675437 | - | 200 | Protein_3207 | capsid portal protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10980.93 Da Isoelectric Point: 10.1716
>T259090 WP_039534786.1 NZ_CP104733:c3672499-3672215 [Pectobacterium sp. F1-1]
MSYKLEFEEHALKEFKKLGAPVREQFTKKLKEVLQNPHVPANRLHGMADCYKIKLRSAGYRLVYQVLEHEIVVLVLAVGK
RERSEVYKAAKDRL
MSYKLEFEEHALKEFKKLGAPVREQFTKKLKEVLQNPHVPANRLHGMADCYKIKLRSAGYRLVYQVLEHEIVVLVLAVGK
RERSEVYKAAKDRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|