Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 1570108..1570661 | Replicon | chromosome |
Accession | NZ_CP104733 | ||
Organism | Pectobacterium sp. F1-1 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | - |
Locus tag | NAL19_RS06860 | Protein ID | WP_263059204.1 |
Coordinates | 1570347..1570661 (+) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | A0A3S1FM98 |
Locus tag | NAL19_RS06855 | Protein ID | WP_029729596.1 |
Coordinates | 1570108..1570344 (+) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NAL19_RS06845 (NAL19_1472) | 1565812..1568121 | - | 2310 | WP_263059202.1 | TerB N-terminal domain-containing protein | - |
NAL19_RS06850 (NAL19_1473) | 1568846..1569790 | + | 945 | WP_263059203.1 | zincin-like metallopeptidase domain-containing protein | - |
NAL19_RS06855 (NAL19_1474) | 1570108..1570344 | + | 237 | WP_029729596.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
NAL19_RS06860 (NAL19_1475) | 1570347..1570661 | + | 315 | WP_263059204.1 | CcdB family protein | Toxin |
NAL19_RS06865 (NAL19_1477) | 1571172..1572341 | + | 1170 | WP_263059205.1 | hypothetical protein | - |
NAL19_RS06870 (NAL19_1478) | 1572577..1573719 | + | 1143 | WP_263059206.1 | reverse transcriptase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 1547475..1602754 | 55279 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11607.58 Da Isoelectric Point: 7.9859
>T259088 WP_263059204.1 NZ_CP104733:1570347-1570661 [Pectobacterium sp. F1-1]
MQFTVYGNTGKSVVYPLLLDVTSDIIGQLNRRIVIPLLPIEKYPAGRRPDRLVPVIRLTDGKEYAVMTHELASIPVQALG
TVFCDVSQYRTQVKAAIDFLIDGF
MQFTVYGNTGKSVVYPLLLDVTSDIIGQLNRRIVIPLLPIEKYPAGRRPDRLVPVIRLTDGKEYAVMTHELASIPVQALG
TVFCDVSQYRTQVKAAIDFLIDGF
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|