Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 1226106..1226731 | Replicon | chromosome |
| Accession | NZ_CP104733 | ||
| Organism | Pectobacterium sp. F1-1 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | C6DB72 |
| Locus tag | NAL19_RS05295 | Protein ID | WP_005976087.1 |
| Coordinates | 1226106..1226309 (-) | Length | 68 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | - |
| Locus tag | NAL19_RS05300 | Protein ID | WP_263058990.1 |
| Coordinates | 1226363..1226731 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NAL19_RS05265 (NAL19_1145) | 1221621..1221959 | + | 339 | WP_002208627.1 | P-II family nitrogen regulator | - |
| NAL19_RS05270 (NAL19_1146) | 1221999..1223285 | + | 1287 | WP_225087233.1 | ammonium transporter AmtB | - |
| NAL19_RS05275 (NAL19_1147) | 1223363..1224226 | - | 864 | WP_263058986.1 | acyl-CoA thioesterase II | - |
| NAL19_RS05280 (NAL19_1148) | 1224439..1225020 | + | 582 | WP_225087235.1 | YbaY family lipoprotein | - |
| NAL19_RS05285 (NAL19_1149) | 1225041..1225361 | - | 321 | WP_015839360.1 | MGMT family protein | - |
| NAL19_RS05295 (NAL19_1150) | 1226106..1226309 | - | 204 | WP_005976087.1 | HHA domain-containing protein | Toxin |
| NAL19_RS05300 (NAL19_1151) | 1226363..1226731 | - | 369 | WP_263058990.1 | Hha toxicity modulator TomB | Antitoxin |
| NAL19_RS05305 (NAL19_1152) | 1227328..1227474 | - | 147 | WP_263058991.1 | type B 50S ribosomal protein L36 | - |
| NAL19_RS05310 (NAL19_1153) | 1227492..1227740 | - | 249 | WP_225087236.1 | type B 50S ribosomal protein L31 | - |
| NAL19_RS05315 (NAL19_1154) | 1227971..1231099 | - | 3129 | WP_263058992.1 | efflux RND transporter permease subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8145.52 Da Isoelectric Point: 8.9008
>T259086 WP_005976087.1 NZ_CP104733:c1226309-1226106 [Pectobacterium sp. F1-1]
MKKIDYLMRLRKCTTIDTLERVIEKNKYELSNDELEMFFSAADHRLAELTMNKLYDKVPTAVWRYVR
MKKIDYLMRLRKCTTIDTLERVIEKNKYELSNDELEMFFSAADHRLAELTMNKLYDKVPTAVWRYVR
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14032.77 Da Isoelectric Point: 4.4787
>AT259086 WP_263058990.1 NZ_CP104733:c1226731-1226363 [Pectobacterium sp. F1-1]
MDEYTPKHYDIAQLRFLCENLCDESIATLGDSSHGWVNDPTSAINIQLNELIEHIATFILTFKIKYPNESELSEQVEKYL
DDTYVLFSNYGINDAELRRWQKSKAKLFGMFSGENVCTPAKT
MDEYTPKHYDIAQLRFLCENLCDESIATLGDSSHGWVNDPTSAINIQLNELIEHIATFILTFKIKYPNESELSEQVEKYL
DDTYVLFSNYGINDAELRRWQKSKAKLFGMFSGENVCTPAKT
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|