Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 794802..795462 | Replicon | chromosome |
| Accession | NZ_CP104733 | ||
| Organism | Pectobacterium sp. F1-1 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | NAL19_RS03520 | Protein ID | WP_250160548.1 |
| Coordinates | 795088..795462 (+) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | C6D8Y5 |
| Locus tag | NAL19_RS03515 | Protein ID | WP_012773340.1 |
| Coordinates | 794802..795068 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NAL19_RS03495 (NAL19_748) | 790750..791754 | - | 1005 | WP_263058766.1 | LacI family DNA-binding transcriptional regulator | - |
| NAL19_RS03500 (NAL19_749) | 791809..792417 | - | 609 | WP_263058767.1 | HD domain-containing protein | - |
| NAL19_RS03505 (NAL19_750) | 792863..793510 | + | 648 | WP_225086922.1 | hemolysin III family protein | - |
| NAL19_RS03510 (NAL19_751) | 793565..794566 | - | 1002 | WP_263058768.1 | tRNA-modifying protein YgfZ | - |
| NAL19_RS03515 (NAL19_752) | 794802..795068 | + | 267 | WP_012773340.1 | FAD assembly factor SdhE | Antitoxin |
| NAL19_RS03520 (NAL19_753) | 795088..795462 | + | 375 | WP_250160548.1 | protein YgfX | Toxin |
| NAL19_RS03525 (NAL19_754) | 795530..796465 | + | 936 | WP_263058769.1 | 23S rRNA (adenine(1618)-N(6))-methyltransferase RlmF | - |
| NAL19_RS03530 (NAL19_755) | 796531..796740 | - | 210 | WP_263058770.1 | hypothetical protein | - |
| NAL19_RS03535 (NAL19_756) | 796806..797326 | - | 521 | Protein_683 | flavodoxin FldB | - |
| NAL19_RS03540 (NAL19_757) | 797488..798813 | - | 1326 | WP_263058771.1 | MFS transporter | - |
| NAL19_RS03545 (NAL19_758) | 799143..800042 | + | 900 | WP_225086929.1 | site-specific tyrosine recombinase XerD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14659.31 Da Isoelectric Point: 10.6585
>T259085 WP_250160548.1 NZ_CP104733:795088-795462 [Pectobacterium sp. F1-1]
MQLLSLVVHGLLVLLILLAPWPDGYAWLWLCLVTMVMFGFIRSQRNIKSRQGEIVLLSETTLNWRQQEWQIVKRPWLLKN
GVLLSLQAVNGKDRQQLWLASDSMGDDEWRHLRQLLLQQKNWAR
MQLLSLVVHGLLVLLILLAPWPDGYAWLWLCLVTMVMFGFIRSQRNIKSRQGEIVLLSETTLNWRQQEWQIVKRPWLLKN
GVLLSLQAVNGKDRQQLWLASDSMGDDEWRHLRQLLLQQKNWAR
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|