Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 187641..188258 | Replicon | chromosome |
Accession | NZ_CP104733 | ||
Organism | Pectobacterium sp. F1-1 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | C6DHN3 |
Locus tag | NAL19_RS00840 | Protein ID | WP_010281507.1 |
Coordinates | 188079..188258 (-) | Length | 60 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | NAL19_RS00835 | Protein ID | WP_263058502.1 |
Coordinates | 187641..188051 (-) | Length | 137 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NAL19_RS00820 (NAL19_179) | 183485..184528 | - | 1044 | WP_263058500.1 | DNA-binding transcriptional regulator CytR | - |
NAL19_RS00825 (NAL19_180) | 184817..187015 | - | 2199 | WP_263058501.1 | primosomal protein N' | - |
NAL19_RS00830 (NAL19_181) | 187329..187544 | + | 216 | WP_010281510.1 | 50S ribosomal protein L31 | - |
NAL19_RS00835 (NAL19_182) | 187641..188051 | - | 411 | WP_263058502.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
NAL19_RS00840 | 188079..188258 | - | 180 | WP_010281507.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
NAL19_RS00845 (NAL19_183) | 188357..189367 | - | 1011 | WP_263058503.1 | iron ABC transporter permease | - |
NAL19_RS00850 (NAL19_184) | 189364..190326 | - | 963 | WP_263059770.1 | ABC transporter substrate-binding protein | - |
NAL19_RS00855 (NAL19_185) | 190336..191133 | - | 798 | WP_263058504.1 | ABC transporter ATP-binding protein | - |
NAL19_RS00860 (NAL19_186) | 191352..191669 | - | 318 | WP_005973355.1 | met regulon transcriptional regulator MetJ | - |
NAL19_RS00865 (NAL19_187) | 191857..193015 | + | 1159 | Protein_172 | cystathionine gamma-synthase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6560.69 Da Isoelectric Point: 10.7838
>T259081 WP_010281507.1 NZ_CP104733:c188258-188079 [Pectobacterium sp. F1-1]
MDSRTLIAEIKADGWELIRVNGSHHHFMHPSKPGLVTIPHPKKDLPIGTVKSIRKQAGI
MDSRTLIAEIKADGWELIRVNGSHHHFMHPSKPGLVTIPHPKKDLPIGTVKSIRKQAGI
Download Length: 180 bp
Antitoxin
Download Length: 137 a.a. Molecular weight: 14508.35 Da Isoelectric Point: 4.2386
>AT259081 WP_263058502.1 NZ_CP104733:c188051-187641 [Pectobacterium sp. F1-1]
MFYPIAIEAGDDTHAYGVTVPDLPGCFSAGDTLDDAITNAKEAITGHIELLIEMGQDIPTVSSVGQLAKSAEYAGYTWAV
VDIDVTRLMGGSEKINVTLPKSLIDRIDRCVASNPEFKSRSGFLAQAALEQISSSR
MFYPIAIEAGDDTHAYGVTVPDLPGCFSAGDTLDDAITNAKEAITGHIELLIEMGQDIPTVSSVGQLAKSAEYAGYTWAV
VDIDVTRLMGGSEKINVTLPKSLIDRIDRCVASNPEFKSRSGFLAQAALEQISSSR
Download Length: 411 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|