Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
Location | 7352365..7352870 | Replicon | chromosome |
Accession | NZ_CP104727 | ||
Organism | Pseudomonas citronellolis strain G5.80 |
Toxin (Protein)
Gene name | parE | Uniprot ID | W5IQ81 |
Locus tag | N5P21_RS32530 | Protein ID | WP_009614629.1 |
Coordinates | 7352589..7352870 (+) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | W5IQE2 |
Locus tag | N5P21_RS32525 | Protein ID | WP_009614631.1 |
Coordinates | 7352365..7352592 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5P21_RS32505 (N5P21_32525) | 7348986..7349387 | - | 402 | WP_261747239.1 | GFA family protein | - |
N5P21_RS32510 (N5P21_32530) | 7349399..7350130 | - | 732 | WP_261747240.1 | phytanoyl-CoA dioxygenase family protein | - |
N5P21_RS32515 (N5P21_32535) | 7350127..7351053 | - | 927 | WP_261747241.1 | LysR family transcriptional regulator | - |
N5P21_RS32520 (N5P21_32540) | 7351128..7352084 | - | 957 | WP_261747242.1 | agmatinase | - |
N5P21_RS32525 (N5P21_32545) | 7352365..7352592 | + | 228 | WP_009614631.1 | CopG family ribbon-helix-helix protein | Antitoxin |
N5P21_RS32530 (N5P21_32550) | 7352589..7352870 | + | 282 | WP_009614629.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N5P21_RS32535 (N5P21_32555) | 7353130..7353861 | + | 732 | WP_261747243.1 | RcnB family protein | - |
N5P21_RS32540 (N5P21_32560) | 7353902..7354183 | - | 282 | WP_069862794.1 | DUF2218 domain-containing protein | - |
N5P21_RS32545 (N5P21_32565) | 7354281..7355198 | + | 918 | WP_261747244.1 | LysR family transcriptional regulator | - |
N5P21_RS32550 (N5P21_32570) | 7355257..7355712 | + | 456 | WP_116425958.1 | GNAT family N-acetyltransferase | - |
N5P21_RS32555 (N5P21_32575) | 7355709..7356326 | - | 618 | WP_261747245.1 | DUF1826 domain-containing protein | - |
N5P21_RS32560 (N5P21_32580) | 7356326..7357528 | - | 1203 | WP_074980504.1 | zinc metallochaperone GTPase ZigA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10251.74 Da Isoelectric Point: 6.4614
>T259078 WP_009614629.1 NZ_CP104727:7352589-7352870 [Pseudomonas citronellolis]
MSLQWTHKAAADLDGLYDHYVVLIGPEKALKAIQDVVGQVKALADLSLSSVGRPSEVPGVRELPLERWPYQAAYRVKGRD
VQILRIDSVDNPG
MSLQWTHKAAADLDGLYDHYVVLIGPEKALKAIQDVVGQVKALADLSLSSVGRPSEVPGVRELPLERWPYQAAYRVKGRD
VQILRIDSVDNPG
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1A5D1B8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1S1GJG7 |