Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 6804735..6805354 | Replicon | chromosome |
| Accession | NZ_CP104727 | ||
| Organism | Pseudomonas citronellolis strain G5.80 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | W5J3G4 |
| Locus tag | N5P21_RS30120 | Protein ID | WP_009615522.1 |
| Coordinates | 6805172..6805354 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | W5J3H2 |
| Locus tag | N5P21_RS30115 | Protein ID | WP_009615524.1 |
| Coordinates | 6804735..6805139 (-) | Length | 135 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5P21_RS30080 (N5P21_30100) | 6800065..6800835 | + | 771 | WP_261747061.1 | NERD domain-containing protein | - |
| N5P21_RS30085 (N5P21_30105) | 6800860..6801282 | - | 423 | WP_058073289.1 | helix-turn-helix domain-containing protein | - |
| N5P21_RS30090 (N5P21_30110) | 6801602..6802786 | + | 1185 | WP_261747062.1 | Fic family protein | - |
| N5P21_RS30095 (N5P21_30115) | 6803174..6803788 | + | 615 | WP_249917989.1 | hypothetical protein | - |
| N5P21_RS30100 (N5P21_30120) | 6804062..6804145 | + | 84 | Protein_5936 | nuclease | - |
| N5P21_RS30105 (N5P21_30125) | 6804146..6804331 | - | 186 | Protein_5937 | VapC toxin family PIN domain ribonuclease | - |
| N5P21_RS30110 (N5P21_30130) | 6804331..6804585 | - | 255 | WP_249917990.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| N5P21_RS30115 (N5P21_30135) | 6804735..6805139 | - | 405 | WP_009615524.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| N5P21_RS30120 (N5P21_30140) | 6805172..6805354 | - | 183 | WP_009615522.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| N5P21_RS30125 (N5P21_30145) | 6805813..6806301 | + | 489 | WP_058073292.1 | Bro-N domain-containing protein | - |
| N5P21_RS30130 (N5P21_30150) | 6806603..6806761 | - | 159 | WP_009615518.1 | YqaE/Pmp3 family membrane protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | acrB / chpE / chpD / chpC / chpB / pilK / pilJ / pilI / pilH / pilG / pilU / pilT | 6801080..7023867 | 222787 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6962.13 Da Isoelectric Point: 12.2993
>T259077 WP_009615522.1 NZ_CP104727:c6805354-6805172 [Pseudomonas citronellolis]
MRSREIMELIRADGWFLVEVKGSHHQFRHFTKKGRVTVPHPRSNLPIGTVNSILRQAGLR
MRSREIMELIRADGWFLVEVKGSHHQFRHFTKKGRVTVPHPRSNLPIGTVNSILRQAGLR
Download Length: 183 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14532.23 Da Isoelectric Point: 4.5714
>AT259077 WP_009615524.1 NZ_CP104727:c6805139-6804735 [Pseudomonas citronellolis]
MKFPVVLHKDADSDYGVTIPDVPGCFSAGGTVSQALENVQEALALHFEGLVADGETLPQAQEVDTHMGNPDYAGGVWAVV
DFDVTPYLGKAVRFNASLPENLLQRIDERVKRDHRYASRSGFLATAALRELSSN
MKFPVVLHKDADSDYGVTIPDVPGCFSAGGTVSQALENVQEALALHFEGLVADGETLPQAQEVDTHMGNPDYAGGVWAVV
DFDVTPYLGKAVRFNASLPENLLQRIDERVKRDHRYASRSGFLATAALRELSSN
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A127MLP4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1A5CY34 |