259075

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE(toxin)
Location 6387990..6388435 Replicon chromosome
Accession NZ_CP104727
Organism Pseudomonas citronellolis strain G5.80

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag N5P21_RS28060 Protein ID WP_074977497.1
Coordinates 6388244..6388435 (+) Length 64 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A4Z0IF85
Locus tag N5P21_RS28055 Protein ID WP_074977500.1
Coordinates 6387990..6388184 (+) Length 65 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5P21_RS28030 (N5P21_28050) 6383026..6384729 + 1704 WP_261746926.1 type IV-A pilus assembly ATPase PilB -
N5P21_RS28035 (N5P21_28055) 6384733..6385951 + 1219 Protein_5539 type II secretion system F family protein -
N5P21_RS28040 (N5P21_28060) 6385955..6386827 + 873 WP_261746927.1 A24 family peptidase -
N5P21_RS28045 (N5P21_28065) 6386901..6387509 + 609 WP_009617624.1 dephospho-CoA kinase -
N5P21_RS28050 (N5P21_28070) 6387506..6387715 + 210 WP_043272268.1 DNA gyrase inhibitor YacG -
N5P21_RS28055 (N5P21_28075) 6387990..6388184 + 195 WP_074977500.1 stability determinant Antitoxin
N5P21_RS28060 (N5P21_28080) 6388244..6388435 + 192 WP_074977497.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
N5P21_RS28065 (N5P21_28085) 6388442..6388657 - 216 WP_043318062.1 hypothetical protein -
N5P21_RS28070 (N5P21_28090) 6388765..6389481 - 717 WP_261746928.1 energy-coupling factor ABC transporter permease -
N5P21_RS28075 (N5P21_28095) 6389478..6389948 - 471 WP_261746929.1 FAD/FMN-containing dehydrogenase -
N5P21_RS28080 (N5P21_28100) 6389952..6390368 - 417 WP_261746930.1 GNAT family N-acetyltransferase -
N5P21_RS28085 (N5P21_28105) 6390501..6391130 + 630 WP_261746931.1 DUF1780 domain-containing protein -
N5P21_RS28090 (N5P21_28110) 6391201..6391374 + 174 WP_009617611.1 DUF3094 family protein -
N5P21_RS28095 (N5P21_28115) 6391421..6392719 + 1299 WP_261746932.1 NAD(P)/FAD-dependent oxidoreductase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(24-61)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 64 a.a.        Molecular weight: 7164.22 Da        Isoelectric Point: 7.3549

>T259075 WP_074977497.1 NZ_CP104727:6388244-6388435 [Pseudomonas citronellolis]
IANGKAPQESAVLPLAQHPYLYRHGRVPGTREVVVHPNYILVYRIDAECIEVISVLHSRQEYP

Download         Length: 192 bp

Antitoxin


Download         Length: 65 a.a.        Molecular weight: 7223.96 Da        Isoelectric Point: 4.6646

>AT259075 WP_074977500.1 NZ_CP104727:6387990-6388184 [Pseudomonas citronellolis]
MSARLSPIVSEFETPEQAASHDRWFRQKVQKSLTDNQPGRPHDEVMVDMDAIIAQAEARSQGND

Download         Length: 195 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A4Z0IF85

References