Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE(toxin) |
| Location | 4291705..4292293 | Replicon | chromosome |
| Accession | NZ_CP104727 | ||
| Organism | Pseudomonas citronellolis strain G5.80 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | N5P21_RS18705 | Protein ID | WP_116425311.1 |
| Coordinates | 4291943..4292293 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A4Z0IXF0 |
| Locus tag | N5P21_RS18700 | Protein ID | WP_074979635.1 |
| Coordinates | 4291705..4291962 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5P21_RS18665 (N5P21_18685) | 4287491..4287868 | - | 378 | WP_116425309.1 | S24 family peptidase | - |
| N5P21_RS18670 (N5P21_18690) | 4288012..4288230 | + | 219 | WP_009619937.1 | hypothetical protein | - |
| N5P21_RS18675 (N5P21_18695) | 4288357..4288572 | - | 216 | WP_009619935.1 | hypothetical protein | - |
| N5P21_RS18685 (N5P21_18705) | 4289265..4289684 | + | 420 | WP_116425310.1 | LytTR family DNA-binding domain-containing protein | - |
| N5P21_RS18690 (N5P21_18710) | 4289990..4290415 | - | 426 | WP_074979636.1 | hydrogenase | - |
| N5P21_RS18695 (N5P21_18715) | 4290847..4291197 | + | 351 | WP_009619928.1 | hypothetical protein | - |
| N5P21_RS18700 (N5P21_18720) | 4291705..4291962 | + | 258 | WP_074979635.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| N5P21_RS18705 (N5P21_18725) | 4291943..4292293 | + | 351 | WP_116425311.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N5P21_RS18715 (N5P21_18735) | 4292908..4293333 | - | 426 | WP_253390771.1 | lipocalin-like domain-containing protein | - |
| N5P21_RS18720 (N5P21_18740) | 4293338..4294174 | - | 837 | WP_253390770.1 | alpha/beta fold hydrolase | - |
| N5P21_RS18725 (N5P21_18745) | 4294171..4295130 | - | 960 | WP_253390769.1 | VOC family protein | - |
| N5P21_RS18730 (N5P21_18750) | 4295168..4295914 | - | 747 | WP_253390768.1 | glucose 1-dehydrogenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13499.53 Da Isoelectric Point: 10.5002
>T259072 WP_116425311.1 NZ_CP104727:4291943-4292293 [Pseudomonas citronellolis]
MTSKTGNNKQIKAPQQDQEDIKQYTLKFKETALKEWDRLKGPVKTQLIKKLGERLVNPRVEKDKLHGSENKDRYKIKLSA
SGYRLVYQVHDTEIVVEVVAVGKRERSAVYNESKKR
MTSKTGNNKQIKAPQQDQEDIKQYTLKFKETALKEWDRLKGPVKTQLIKKLGERLVNPRVEKDKLHGSENKDRYKIKLSA
SGYRLVYQVHDTEIVVEVVAVGKRERSAVYNESKKR
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|