Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1001374..1002041 | Replicon | chromosome |
Accession | NZ_CP104727 | ||
Organism | Pseudomonas citronellolis strain G5.80 |
Toxin (Protein)
Gene name | VapC1 | Uniprot ID | W5ISM6 |
Locus tag | N5P21_RS04340 | Protein ID | WP_009613158.1 |
Coordinates | 1001374..1001784 (-) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | VapB1 | Uniprot ID | - |
Locus tag | N5P21_RS04345 | Protein ID | WP_253412216.1 |
Coordinates | 1001781..1002041 (-) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5P21_RS04320 (N5P21_04320) | 997356..997889 | + | 534 | WP_009613171.1 | (2Fe-2S)-binding protein | - |
N5P21_RS04325 (N5P21_04325) | 997892..999127 | + | 1236 | WP_253412218.1 | cytochrome c | - |
N5P21_RS04330 (N5P21_04330) | 999129..1000097 | + | 969 | WP_074982920.1 | XdhC family protein | - |
N5P21_RS04335 (N5P21_04335) | 1000094..1000669 | + | 576 | WP_074982922.1 | nucleotidyltransferase family protein | - |
N5P21_RS04340 (N5P21_04340) | 1001374..1001784 | - | 411 | WP_009613158.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
N5P21_RS04345 (N5P21_04345) | 1001781..1002041 | - | 261 | WP_253412216.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
N5P21_RS04350 (N5P21_04350) | 1002124..1003248 | - | 1125 | WP_261748720.1 | class I SAM-dependent methyltransferase | - |
N5P21_RS04355 (N5P21_04355) | 1003377..1004153 | + | 777 | WP_061562836.1 | ferredoxin--NADP reductase | - |
N5P21_RS04360 (N5P21_04360) | 1004342..1005895 | + | 1554 | WP_261747566.1 | TerC family protein | - |
N5P21_RS04365 (N5P21_04365) | 1005913..1006326 | - | 414 | WP_261747567.1 | large-conductance mechanosensitive channel protein MscL | - |
N5P21_RS04370 (N5P21_04370) | 1006519..1006761 | + | 243 | WP_074981193.1 | YdcH family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 15448.80 Da Isoelectric Point: 7.1891
>T259066 WP_009613158.1 NZ_CP104727:c1001784-1001374 [Pseudomonas citronellolis]
VKYLLDTNILIYLLKNRPESVARRVNALPADAGLCMSFFTYAELLKGAERSTRRSEVLRQLERLTRQVPVVYDGTPRLCE
HYATQFTRLKLAGTPIGANDLWIACHALALEATLVTHNTREFERIDGLCLEDWAAE
VKYLLDTNILIYLLKNRPESVARRVNALPADAGLCMSFFTYAELLKGAERSTRRSEVLRQLERLTRQVPVVYDGTPRLCE
HYATQFTRLKLAGTPIGANDLWIACHALALEATLVTHNTREFERIDGLCLEDWAAE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|