Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 976823..977397 | Replicon | chromosome |
Accession | NZ_CP104727 | ||
Organism | Pseudomonas citronellolis strain G5.80 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A4Z0IFX5 |
Locus tag | N5P21_RS04235 | Protein ID | WP_058073004.1 |
Coordinates | 977032..977397 (+) | Length | 122 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | W5ISP5 |
Locus tag | N5P21_RS04230 | Protein ID | WP_009613188.1 |
Coordinates | 976823..977038 (+) | Length | 72 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5P21_RS04215 (N5P21_04215) | 972523..973341 | + | 819 | WP_116424330.1 | ABC transporter permease subunit | - |
N5P21_RS04220 (N5P21_04220) | 973525..974361 | + | 837 | WP_261747561.1 | taurine dioxygenase | - |
N5P21_RS04225 (N5P21_04225) | 974730..976754 | + | 2025 | WP_261747562.1 | oligopeptide transporter, OPT family | - |
N5P21_RS04230 (N5P21_04230) | 976823..977038 | + | 216 | WP_009613188.1 | CopG family transcriptional regulator | Antitoxin |
N5P21_RS04235 (N5P21_04235) | 977032..977397 | + | 366 | WP_058073004.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
N5P21_RS04240 (N5P21_04240) | 977385..978110 | - | 726 | WP_074982893.1 | hypothetical protein | - |
N5P21_RS04245 (N5P21_04245) | 978107..978289 | - | 183 | WP_074982895.1 | hypothetical protein | - |
N5P21_RS04250 (N5P21_04250) | 978286..979434 | - | 1149 | WP_261747563.1 | PepSY domain-containing protein | - |
N5P21_RS04255 (N5P21_04255) | 979442..981853 | - | 2412 | WP_261747564.1 | TonB-dependent receptor | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 13380.44 Da Isoelectric Point: 5.8613
>T259065 WP_058073004.1 NZ_CP104727:977032-977397 [Pseudomonas citronellolis]
MVKALFDTNILIDYLNGHEQARDELRRYDDPAISIVTWMEVMIGATPATAAATRAFLDSFALVPLDASVAERAVAVRQAL
RVKLPDAIIKASAEVQGRLLVTRNTRDFPVDDAGVRLPYRL
MVKALFDTNILIDYLNGHEQARDELRRYDDPAISIVTWMEVMIGATPATAAATRAFLDSFALVPLDASVAERAVAVRQAL
RVKLPDAIIKASAEVQGRLLVTRNTRDFPVDDAGVRLPYRL
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4Z0IFX5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1A5D6Z2 |