Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 68616..69259 | Replicon | plasmid pSG.H2a_1 |
Accession | NZ_CP104725 | ||
Organism | Enterobacter kobei strain SG.H2a |
Toxin (Protein)
Gene name | vagD | Uniprot ID | - |
Locus tag | N5P26_RS21990 | Protein ID | WP_261660357.1 |
Coordinates | 68616..69032 (-) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | - |
Locus tag | N5P26_RS21995 | Protein ID | WP_261660358.1 |
Coordinates | 69029..69259 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5P26_RS21985 (N5P26_21985) | 67841..68584 | - | 744 | WP_261660356.1 | hypothetical protein | - |
N5P26_RS21990 (N5P26_21990) | 68616..69032 | - | 417 | WP_261660357.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
N5P26_RS21995 (N5P26_21995) | 69029..69259 | - | 231 | WP_261660358.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
N5P26_RS22000 (N5P26_22000) | 70048..71022 | + | 975 | WP_261660359.1 | sensor domain-containing diguanylate cyclase | - |
N5P26_RS22005 (N5P26_22005) | 71599..71892 | + | 294 | WP_261660360.1 | hypothetical protein | - |
N5P26_RS22010 (N5P26_22010) | 71971..72678 | + | 708 | WP_261660361.1 | hypothetical protein | - |
N5P26_RS22015 (N5P26_22015) | 72720..73463 | + | 744 | WP_261660362.1 | site-specific integrase | - |
N5P26_RS22020 (N5P26_22020) | 73651..73920 | + | 270 | Protein_81 | site-specific integrase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..134081 | 134081 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15276.59 Da Isoelectric Point: 7.7522
>T259064 WP_261660357.1 NZ_CP104725:c69032-68616 [Enterobacter kobei]
VNKTYMLDTCICSFIMREQPETVRKRLEQAVLRGNRIVISAITYQEMRFGATGPKASPRHVQLVDEFCTRLDAVLPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLNLEDWVK
VNKTYMLDTCICSFIMREQPETVRKRLEQAVLRGNRIVISAITYQEMRFGATGPKASPRHVQLVDEFCTRLDAVLPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLNLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|