Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1076306..1076926 | Replicon | chromosome |
Accession | NZ_CP104724 | ||
Organism | Enterobacter kobei strain SG.H2a |
Toxin (Protein)
Gene name | Hha | Uniprot ID | A0A2W0G488 |
Locus tag | N5P26_RS05055 | Protein ID | WP_014882802.1 |
Coordinates | 1076306..1076524 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V3PBI9 |
Locus tag | N5P26_RS05060 | Protein ID | WP_008499288.1 |
Coordinates | 1076552..1076926 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5P26_RS05025 (N5P26_05025) | 1072315..1072575 | + | 261 | WP_261660346.1 | type B 50S ribosomal protein L31 | - |
N5P26_RS05030 (N5P26_05030) | 1072578..1072718 | + | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
N5P26_RS05035 (N5P26_05035) | 1072715..1073425 | - | 711 | WP_069601783.1 | GNAT family protein | - |
N5P26_RS05040 (N5P26_05040) | 1073527..1074987 | + | 1461 | WP_014882799.1 | PLP-dependent aminotransferase family protein | - |
N5P26_RS05045 (N5P26_05045) | 1074959..1075426 | - | 468 | WP_014882800.1 | YlaC family protein | - |
N5P26_RS05050 (N5P26_05050) | 1075545..1076096 | - | 552 | WP_014882801.1 | maltose O-acetyltransferase | - |
N5P26_RS05055 (N5P26_05055) | 1076306..1076524 | - | 219 | WP_014882802.1 | HHA domain-containing protein | Toxin |
N5P26_RS05060 (N5P26_05060) | 1076552..1076926 | - | 375 | WP_008499288.1 | Hha toxicity modulator TomB | Antitoxin |
N5P26_RS05065 (N5P26_05065) | 1077438..1080584 | - | 3147 | WP_014882803.1 | multidrug efflux RND transporter permease subunit AcrB | - |
N5P26_RS05070 (N5P26_05070) | 1080607..1081800 | - | 1194 | WP_014882804.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8612.00 Da Isoelectric Point: 8.9008
>T259057 WP_014882802.1 NZ_CP104724:c1076524-1076306 [Enterobacter kobei]
MSEKPLTKVDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFVR
MSEKPLTKVDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFVR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14481.28 Da Isoelectric Point: 4.8886
>AT259057 WP_008499288.1 NZ_CP104724:c1076926-1076552 [Enterobacter kobei]
MDEYSPKRHDIAQLKFLCESLYHDCLANLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFVNVSRANPVSLSC
MDEYSPKRHDIAQLKFLCESLYHDCLANLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFVNVSRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2W0G488 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V3PBI9 |