Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
| Location | 4246104..4246699 | Replicon | chromosome |
| Accession | NZ_CP104721 | ||
| Organism | Escherichia coli strain ECO3183 | ||
Toxin (Protein)
| Gene name | chpB | Uniprot ID | U9Y4M4 |
| Locus tag | N5O92_RS20400 | Protein ID | WP_000239579.1 |
| Coordinates | 4246104..4246454 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | chpS | Uniprot ID | U9Y2K1 |
| Locus tag | N5O92_RS20405 | Protein ID | WP_001223208.1 |
| Coordinates | 4246448..4246699 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5O92_RS20380 (4241551) | 4241551..4242575 | - | 1025 | Protein_3986 | ABC transporter permease | - |
| N5O92_RS20385 (4242586) | 4242586..4244088 | - | 1503 | WP_000205784.1 | sugar ABC transporter ATP-binding protein | - |
| N5O92_RS20390 (4244228) | 4244228..4245184 | - | 957 | WP_000265933.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
| N5O92_RS20395 (4245494) | 4245494..4246024 | + | 531 | WP_000055072.1 | inorganic diphosphatase | - |
| N5O92_RS20400 (4246104) | 4246104..4246454 | - | 351 | WP_000239579.1 | endoribonuclease toxin ChpB | Toxin |
| N5O92_RS20405 (4246448) | 4246448..4246699 | - | 252 | WP_001223208.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
| N5O92_RS20410 (4246911) | 4246911..4247252 | - | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
| N5O92_RS20415 (4247255) | 4247255..4251034 | - | 3780 | WP_000060978.1 | autotransporter assembly complex protein TamB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12511.45 Da Isoelectric Point: 5.6219
>T259052 WP_000239579.1 NZ_CP104721:c4246454-4246104 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0Y8A8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LQ26 |