Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 795991..796823 Replicon chromosome
Accession NZ_CP104721
Organism Escherichia coli strain ECO3183

Toxin (Protein)


Gene name yeeV Uniprot ID A7ZVJ9
Locus tag N5O92_RS03865 Protein ID WP_000854765.1
Coordinates 795991..796365 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID S1NM52
Locus tag N5O92_RS03870 Protein ID WP_001295723.1
Coordinates 796455..796823 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5O92_RS03830 (791069) 791069..791668 + 600 WP_001255034.1 type II secretion system minor pseudopilin GspJ -
N5O92_RS03835 (791671) 791671..792648 + 978 WP_000633209.1 type II secretion system minor pseudopilin GspK -
N5O92_RS03840 (792645) 792645..793823 + 1179 WP_000094991.1 type II secretion system protein GspL -
N5O92_RS03845 (793825) 793825..794361 + 537 WP_000942785.1 GspM family type II secretion system protein YghD -
N5O92_RS03850 (794642) 794642..795484 - 843 WP_022645115.1 DUF4942 domain-containing protein -
N5O92_RS03855 (795569) 795569..795763 - 195 WP_024181941.1 DUF957 domain-containing protein -
N5O92_RS03860 (795788) 795788..795991 - 204 WP_001398797.1 DUF5983 family protein -
N5O92_RS03865 (795991) 795991..796365 - 375 WP_000854765.1 TA system toxin CbtA family protein Toxin
N5O92_RS03870 (796455) 796455..796823 - 369 WP_001295723.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
N5O92_RS03875 (796986) 796986..797207 - 222 WP_000692341.1 DUF987 domain-containing protein -
N5O92_RS03880 (797270) 797270..797746 - 477 WP_001186774.1 RadC family protein -
N5O92_RS03885 (797762) 797762..798241 - 480 WP_057109541.1 antirestriction protein -
N5O92_RS03890 (798507) 798507..799325 - 819 WP_001175165.1 DUF932 domain-containing protein -
N5O92_RS03895 (799415) 799415..799648 - 234 WP_001278293.1 DUF905 family protein -
N5O92_RS03900 (799654) 799654..800331 - 678 WP_001097302.1 hypothetical protein -
N5O92_RS03905 (800479) 800479..801159 - 681 WP_001282921.1 WYL domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13970.98 Da        Isoelectric Point: 7.2909

>T259038 WP_000854765.1 NZ_CP104721:c796365-795991 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13592.40 Da        Isoelectric Point: 6.6255

>AT259038 WP_001295723.1 NZ_CP104721:c796823-796455 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A7ZVJ9

Antitoxin

Source ID Structure
AlphaFold DB S1NM52

References