Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
| Location | 144178..144683 | Replicon | chromosome |
| Accession | NZ_CP104720 | ||
| Organism | Pseudomonas aeruginosa strain NY4593 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | V6A7K8 |
| Locus tag | N5P33_RS00660 | Protein ID | WP_003083773.1 |
| Coordinates | 144178..144459 (-) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | Q9I707 |
| Locus tag | N5P33_RS00665 | Protein ID | WP_003112628.1 |
| Coordinates | 144456..144683 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5P33_RS00635 (N5P33_00635) | 139429..140778 | + | 1350 | WP_003142411.1 | C4-dicarboxylate transporter DctA | - |
| N5P33_RS00640 (N5P33_00640) | 140827..141513 | + | 687 | WP_003083762.1 | FadR/GntR family transcriptional regulator | - |
| N5P33_RS00645 (N5P33_00645) | 141614..142348 | + | 735 | WP_003117208.1 | GntR family transcriptional regulator | - |
| N5P33_RS00650 (N5P33_00650) | 142528..142938 | + | 411 | WP_003101225.1 | aegerolysin family protein | - |
| N5P33_RS00655 (N5P33_00655) | 142970..143878 | - | 909 | WP_003083769.1 | LysR family transcriptional regulator | - |
| N5P33_RS00660 (N5P33_00660) | 144178..144459 | - | 282 | WP_003083773.1 | type II toxin-antitoxin system toxin ParE | Toxin |
| N5P33_RS00665 (N5P33_00665) | 144456..144683 | - | 228 | WP_003112628.1 | CopG family ribbon-helix-helix protein | Antitoxin |
| N5P33_RS00670 (N5P33_00670) | 144859..145479 | - | 621 | WP_003101226.1 | hypothetical protein | - |
| N5P33_RS00675 (N5P33_00675) | 145580..146080 | + | 501 | WP_003112629.1 | LEA type 2 family protein | - |
| N5P33_RS00680 (N5P33_00680) | 146153..146494 | + | 342 | WP_003101229.1 | zinc ribbon domain-containing protein YjdM | - |
| N5P33_RS00685 (N5P33_00685) | 146576..148003 | - | 1428 | WP_003083784.1 | GABA permease | - |
| N5P33_RS00690 (N5P33_00690) | 148172..149665 | - | 1494 | WP_003101230.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10462.19 Da Isoelectric Point: 10.0435
>T259029 WP_003083773.1 NZ_CP104720:c144459-144178 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|