Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 3289509..3290158 | Replicon | chromosome |
| Accession | NZ_CP104698 | ||
| Organism | Proteus mirabilis strain NG-ABK-32 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | B4EZB9 |
| Locus tag | N6W67_RS15670 | Protein ID | WP_012368534.1 |
| Coordinates | 3289509..3289928 (-) | Length | 140 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | B4EZC0 |
| Locus tag | N6W67_RS15675 | Protein ID | WP_012368535.1 |
| Coordinates | 3289925..3290158 (-) | Length | 78 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N6W67_RS15640 (N6W67_15640) | 3284786..3285664 | - | 879 | WP_049203255.1 | 23S rRNA pseudouridine(2604) synthase RluF | - |
| N6W67_RS15645 (N6W67_15645) | 3285840..3286754 | - | 915 | WP_004249085.1 | fatty acid biosynthesis protein FabY | - |
| N6W67_RS15650 (N6W67_15650) | 3286778..3287215 | - | 438 | WP_004246810.1 | D-aminoacyl-tRNA deacylase | - |
| N6W67_RS15655 (N6W67_15655) | 3287296..3287913 | - | 618 | WP_004246809.1 | glucose-1-phosphatase | - |
| N6W67_RS15660 (N6W67_15660) | 3288567..3288983 | - | 417 | WP_049208252.1 | hypothetical protein | - |
| N6W67_RS15665 (N6W67_15665) | 3288961..3289284 | - | 324 | WP_049208253.1 | hypothetical protein | - |
| N6W67_RS15670 (N6W67_15670) | 3289509..3289928 | - | 420 | WP_012368534.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| N6W67_RS15675 (N6W67_15675) | 3289925..3290158 | - | 234 | WP_012368535.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| N6W67_RS15680 (N6W67_15680) | 3290909..3292744 | - | 1836 | WP_004246802.1 | ribosome-dependent GTPase TypA | - |
| N6W67_RS15685 (N6W67_15685) | 3293104..3294513 | + | 1410 | WP_004246801.1 | glutamate--ammonia ligase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15371.88 Da Isoelectric Point: 7.7288
>T259026 WP_012368534.1 NZ_CP104698:c3289928-3289509 [Proteus mirabilis]
VKKVYMLDTNICSFIMREQPISLLEKLQKCVMNHDTIVISAITYSEMRFGAIGKKASPKHNRLVDAFCERVDAILAWDKA
AVDATTVIKKCLSDVGLPIGNNDSAIAGHAVAVNAILVTNNTREFSRVEGLKIEDWTHV
VKKVYMLDTNICSFIMREQPISLLEKLQKCVMNHDTIVISAITYSEMRFGAIGKKASPKHNRLVDAFCERVDAILAWDKA
AVDATTVIKKCLSDVGLPIGNNDSAIAGHAVAVNAILVTNNTREFSRVEGLKIEDWTHV
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|