Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 137656..138182 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP104692 | ||
| Organism | Enterobacter hormaechei strain 2022CK-00453 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A7R6HXL1 |
| Locus tag | N5934_RS23295 | Protein ID | WP_015572079.1 |
| Coordinates | 137895..138182 (+) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | S1F6D3 |
| Locus tag | N5934_RS23290 | Protein ID | WP_000534858.1 |
| Coordinates | 137656..137895 (+) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5934_RS23260 (N5934_23260) | 132728..133664 | - | 937 | Protein_151 | GlxA family transcriptional regulator | - |
| N5934_RS23265 (N5934_23265) | 133675..134877 | - | 1203 | WP_015572077.1 | MFS transporter | - |
| N5934_RS23270 (N5934_23270) | 134917..135678 | - | 762 | WP_004118132.1 | SDR family NAD(P)-dependent oxidoreductase | - |
| N5934_RS23275 (N5934_23275) | 135708..136523 | - | 816 | WP_032670836.1 | SDR family oxidoreductase | - |
| N5934_RS23280 (N5934_23280) | 136987..137307 | + | 321 | WP_004197483.1 | hypothetical protein | - |
| N5934_RS23285 (N5934_23285) | 137529..137631 | - | 103 | Protein_156 | hypothetical protein | - |
| N5934_RS23290 (N5934_23290) | 137656..137895 | + | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
| N5934_RS23295 (N5934_23295) | 137895..138182 | + | 288 | WP_015572079.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N5934_RS23300 (N5934_23300) | 138254..138412 | + | 159 | WP_013087178.1 | type I toxin-antitoxin system Hok family toxin | - |
| N5934_RS23305 (N5934_23305) | 139281..139574 | + | 294 | WP_032670838.1 | hypothetical protein | - |
| N5934_RS23310 (N5934_23310) | 139591..140412 | + | 822 | WP_015572081.1 | DUF932 domain-containing protein | - |
| N5934_RS23315 (N5934_23315) | 140441..140980 | - | 540 | WP_032664846.1 | lytic transglycosylase domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..143089 | 143089 | |
| - | flank | IS/Tn | - | - | 141365..143071 | 1706 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11209.09 Da Isoelectric Point: 10.0714
>T259023 WP_015572079.1 NZ_CP104692:137895-138182 [Enterobacter hormaechei]
MAYFLDFDERALKEWRKLGSTVREQLKNKLAEVLESPRIDANKLRGMHDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKNKLAEVLESPRIDANKLRGMHDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 4FXE | |
| PDB | 2KC8 | |
| PDB | 2K29 | |
| AlphaFold DB | A0A4V1CTS8 |