Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4557952..4558691 | Replicon | chromosome |
Accession | NZ_CP104691 | ||
Organism | Enterobacter hormaechei strain 2022CK-00453 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | A0A801DRD7 |
Locus tag | N5934_RS21985 | Protein ID | WP_017693417.1 |
Coordinates | 4558206..4558691 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | A0A837FCR9 |
Locus tag | N5934_RS21980 | Protein ID | WP_003857131.1 |
Coordinates | 4557952..4558218 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5934_RS21960 (N5934_21960) | 4553434..4554420 | + | 987 | WP_023296632.1 | DUF979 domain-containing protein | - |
N5934_RS21965 (N5934_21965) | 4554430..4555425 | + | 996 | WP_015570513.1 | DUF2891 domain-containing protein | - |
N5934_RS21970 (N5934_21970) | 4555447..4556829 | - | 1383 | WP_110870590.1 | MFS transporter | - |
N5934_RS21975 (N5934_21975) | 4556959..4557888 | + | 930 | WP_110870592.1 | LysR family transcriptional regulator | - |
N5934_RS21980 (N5934_21980) | 4557952..4558218 | + | 267 | WP_003857131.1 | DUF1778 domain-containing protein | Antitoxin |
N5934_RS21985 (N5934_21985) | 4558206..4558691 | + | 486 | WP_017693417.1 | GNAT family N-acetyltransferase | Toxin |
N5934_RS21990 (N5934_21990) | 4558869..4560161 | - | 1293 | WP_110870594.1 | glycosyl hydrolase family 28 protein | - |
N5934_RS21995 (N5934_21995) | 4560266..4561024 | - | 759 | WP_047637345.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
N5934_RS22000 (N5934_22000) | 4561111..4561695 | + | 585 | WP_017382349.1 | GDP-mannose pyrophosphatase nudK | - |
N5934_RS22005 (N5934_22005) | 4561780..4562538 | + | 759 | WP_063151482.1 | trans-aconitate 2-methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17570.26 Da Isoelectric Point: 9.9658
>T259021 WP_017693417.1 NZ_CP104691:4558206-4558691 [Enterobacter hormaechei]
VGRVTAPEPLSSVHQLAEFVSGEAVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTQATGNLRRNM
PDPIPVIILARLAVDVSLRGNGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKTFYIHHGFKASQTQERTLFLRLP
Q
VGRVTAPEPLSSVHQLAEFVSGEAVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTQATGNLRRNM
PDPIPVIILARLAVDVSLRGNGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKTFYIHHGFKASQTQERTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|