Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 3181027..3181684 | Replicon | chromosome |
| Accession | NZ_CP104691 | ||
| Organism | Enterobacter hormaechei strain 2022CK-00453 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A7T9SH06 |
| Locus tag | N5934_RS15520 | Protein ID | WP_023295382.1 |
| Coordinates | 3181274..3181684 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | G8LDB7 |
| Locus tag | N5934_RS15515 | Protein ID | WP_003863437.1 |
| Coordinates | 3181027..3181293 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5934_RS15495 (N5934_15495) | 3176433..3177866 | - | 1434 | WP_017382891.1 | 6-phospho-beta-glucosidase BglA | - |
| N5934_RS15500 (N5934_15500) | 3177986..3178714 | - | 729 | WP_039269836.1 | MurR/RpiR family transcriptional regulator | - |
| N5934_RS15505 (N5934_15505) | 3178981..3179640 | + | 660 | WP_003863433.1 | hemolysin III family protein | - |
| N5934_RS15510 (N5934_15510) | 3179752..3180732 | - | 981 | WP_039269839.1 | tRNA-modifying protein YgfZ | - |
| N5934_RS15515 (N5934_15515) | 3181027..3181293 | + | 267 | WP_003863437.1 | FAD assembly factor SdhE | Antitoxin |
| N5934_RS15520 (N5934_15520) | 3181274..3181684 | + | 411 | WP_023295382.1 | protein YgfX | Toxin |
| N5934_RS15525 (N5934_15525) | 3181686..3182207 | - | 522 | WP_015571793.1 | flavodoxin FldB | - |
| N5934_RS15530 (N5934_15530) | 3182309..3183205 | + | 897 | WP_261655898.1 | site-specific tyrosine recombinase XerD | - |
| N5934_RS15535 (N5934_15535) | 3183234..3183947 | + | 714 | WP_015571792.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| N5934_RS15540 (N5934_15540) | 3183953..3185686 | + | 1734 | WP_017382886.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16291.18 Da Isoelectric Point: 11.4775
>T259016 WP_023295382.1 NZ_CP104691:3181274-3181684 [Enterobacter hormaechei]
VVLWQSDLRVSWRSQWMSLLLHGLVAALVLLVPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWEMMGAPWMLNTGMMLRLRRVEDNRRQHLWLAADSMDPAEWRDLRRLIVQQPTQE
VVLWQSDLRVSWRSQWMSLLLHGLVAALVLLVPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWEMMGAPWMLNTGMMLRLRRVEDNRRQHLWLAADSMDPAEWRDLRRLIVQQPTQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7T9SH06 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A837F8P5 |