Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 2338023..2338639 | Replicon | chromosome |
| Accession | NZ_CP104691 | ||
| Organism | Enterobacter hormaechei strain 2022CK-00453 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | N5934_RS11465 | Protein ID | WP_077266491.1 |
| Coordinates | 2338268..2338639 (+) | Length | 124 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A6G4MTK3 |
| Locus tag | N5934_RS11460 | Protein ID | WP_015569912.1 |
| Coordinates | 2338023..2338265 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5934_RS11430 (N5934_11430) | 2333082..2333882 | + | 801 | WP_261656890.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| N5934_RS11435 (N5934_11435) | 2334001..2334600 | + | 600 | WP_017694048.1 | glucose-1-phosphatase | - |
| N5934_RS11440 (N5934_11440) | 2334594..2335475 | + | 882 | WP_003861949.1 | virulence factor BrkB family protein | - |
| N5934_RS11445 (N5934_11445) | 2335472..2335909 | + | 438 | WP_015569909.1 | D-aminoacyl-tRNA deacylase | - |
| N5934_RS11450 (N5934_11450) | 2335954..2336895 | + | 942 | WP_015569910.1 | fatty acid biosynthesis protein FabY | - |
| N5934_RS11455 (N5934_11455) | 2336904..2337824 | - | 921 | WP_017382675.1 | alpha/beta hydrolase | - |
| N5934_RS11460 (N5934_11460) | 2338023..2338265 | + | 243 | WP_015569912.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| N5934_RS11465 (N5934_11465) | 2338268..2338639 | + | 372 | WP_077266491.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| N5934_RS11470 (N5934_11470) | 2338679..2339608 | - | 930 | WP_003861956.1 | formate dehydrogenase accessory protein FdhE | - |
| N5934_RS11475 (N5934_11475) | 2339605..2340240 | - | 636 | WP_003861958.1 | formate dehydrogenase cytochrome b556 subunit | - |
| N5934_RS11480 (N5934_11480) | 2340237..2341139 | - | 903 | WP_014072386.1 | formate dehydrogenase subunit beta | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13723.85 Da Isoelectric Point: 6.4882
>T259015 WP_077266491.1 NZ_CP104691:2338268-2338639 [Enterobacter hormaechei]
MEHMAVFDTNILIDLFNNRVEAADAIEHTASHRAISLITWMEVMVGARRHGHEAKTAAVMGAFEIIDVSRDIAERSVLLR
EKHGMKLPDAIILATAQSRKCPLISRNTKDFAGIDEVLTPYQV
MEHMAVFDTNILIDLFNNRVEAADAIEHTASHRAISLITWMEVMVGARRHGHEAKTAAVMGAFEIIDVSRDIAERSVLLR
EKHGMKLPDAIILATAQSRKCPLISRNTKDFAGIDEVLTPYQV
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|