Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
| Location | 1608480..1609056 | Replicon | chromosome |
| Accession | NZ_CP104691 | ||
| Organism | Enterobacter hormaechei strain 2022CK-00453 | ||
Toxin (Protein)
| Gene name | shpA | Uniprot ID | A0A800YKM1 |
| Locus tag | N5934_RS07965 | Protein ID | WP_015572580.1 |
| Coordinates | 1608769..1609056 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | shpB | Uniprot ID | A0A801DSF4 |
| Locus tag | N5934_RS07960 | Protein ID | WP_017694570.1 |
| Coordinates | 1608480..1608782 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5934_RS07940 (N5934_07940) | 1604776..1605321 | + | 546 | WP_006810254.1 | YfaZ family outer membrane protein | - |
| N5934_RS07945 (N5934_07945) | 1605498..1606868 | - | 1371 | WP_110871120.1 | NAD-dependent succinate-semialdehyde dehydrogenase | - |
| N5934_RS07950 (N5934_07950) | 1607022..1607774 | + | 753 | WP_033486709.1 | AraC family transcriptional regulator | - |
| N5934_RS07955 (N5934_07955) | 1607813..1608451 | + | 639 | WP_110871122.1 | LysE family translocator | - |
| N5934_RS07960 (N5934_07960) | 1608480..1608782 | - | 303 | WP_017694570.1 | BrnA antitoxin family protein | Antitoxin |
| N5934_RS07965 (N5934_07965) | 1608769..1609056 | - | 288 | WP_015572580.1 | BrnT family toxin | Toxin |
| N5934_RS07970 (N5934_07970) | 1609226..1610497 | + | 1272 | WP_110871124.1 | DUF445 domain-containing protein | - |
| N5934_RS07975 (N5934_07975) | 1610494..1611570 | - | 1077 | WP_015572578.1 | DUF2955 domain-containing protein | - |
| N5934_RS07980 (N5934_07980) | 1611560..1612627 | - | 1068 | WP_108394134.1 | HlyD family secretion protein | - |
| N5934_RS07985 (N5934_07985) | 1612624..1613094 | - | 471 | WP_023295868.1 | MarR family transcriptional regulator | - |
| N5934_RS07990 (N5934_07990) | 1613244..1613963 | - | 720 | WP_045330246.1 | winged helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11296.81 Da Isoelectric Point: 7.3587
>T259014 WP_015572580.1 NZ_CP104691:c1609056-1608769 [Enterobacter hormaechei]
MPIEYEWDSNKAKSNLQKHAIRFEDAVLVFDDPCHLSVQDRYENGEFRWQTIGLVQGVIVILVAHTVRFESGDEIIRIIS
ARKADRKERRRYEHR
MPIEYEWDSNKAKSNLQKHAIRFEDAVLVFDDPCHLSVQDRYENGEFRWQTIGLVQGVIVILVAHTVRFESGDEIIRIIS
ARKADRKERRRYEHR
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|