Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 1138656..1139276 | Replicon | chromosome |
| Accession | NZ_CP104691 | ||
| Organism | Enterobacter hormaechei strain 2022CK-00453 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | A0A837FFM2 |
| Locus tag | N5934_RS05780 | Protein ID | WP_015571250.1 |
| Coordinates | 1139058..1139276 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | F5RUW7 |
| Locus tag | N5934_RS05775 | Protein ID | WP_006809850.1 |
| Coordinates | 1138656..1139030 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5934_RS05765 (N5934_05765) | 1133783..1134976 | + | 1194 | WP_017694395.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| N5934_RS05770 (N5934_05770) | 1134999..1138145 | + | 3147 | WP_015571248.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| N5934_RS05775 (N5934_05775) | 1138656..1139030 | + | 375 | WP_006809850.1 | Hha toxicity modulator TomB | Antitoxin |
| N5934_RS05780 (N5934_05780) | 1139058..1139276 | + | 219 | WP_015571250.1 | HHA domain-containing protein | Toxin |
| N5934_RS05785 (N5934_05785) | 1139485..1140036 | + | 552 | WP_110870982.1 | maltose O-acetyltransferase | - |
| N5934_RS05790 (N5934_05790) | 1140153..1140620 | + | 468 | WP_023296041.1 | YlaC family protein | - |
| N5934_RS05795 (N5934_05795) | 1140592..1142052 | - | 1461 | WP_261656130.1 | PLP-dependent aminotransferase family protein | - |
| N5934_RS05800 (N5934_05800) | 1142154..1142864 | + | 711 | WP_110870984.1 | GNAT family protein | - |
| N5934_RS05805 (N5934_05805) | 1142861..1143001 | - | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
| N5934_RS05810 (N5934_05810) | 1143004..1143264 | - | 261 | WP_015571255.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8583.95 Da Isoelectric Point: 8.9008
>T259013 WP_015571250.1 NZ_CP104691:1139058-1139276 [Enterobacter hormaechei]
MSDKPLTKVDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFVR
MSDKPLTKVDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFVR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14497.28 Da Isoelectric Point: 4.8989
>AT259013 WP_006809850.1 NZ_CP104691:1138656-1139030 [Enterobacter hormaechei]
MDEYSPKRHDIAQLKFLCESLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFTNVSRANPVSLSC
MDEYSPKRHDIAQLKFLCESLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFTNVSRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A837FFM2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A837FGN8 |