Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | KacT-ataR/DUF1778(antitoxin) |
| Location | 538232..539029 | Replicon | chromosome |
| Accession | NZ_CP104691 | ||
| Organism | Enterobacter hormaechei strain 2022CK-00453 | ||
Toxin (Protein)
| Gene name | KacT | Uniprot ID | - |
| Locus tag | N5934_RS02985 | Protein ID | WP_110870847.1 |
| Coordinates | 538232..538753 (-) | Length | 174 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | A0A331QJY7 |
| Locus tag | N5934_RS02990 | Protein ID | WP_015570876.1 |
| Coordinates | 538760..539029 (-) | Length | 90 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5934_RS02955 (N5934_02955) | 533830..534519 | + | 690 | WP_045349209.1 | pyrimidine utilization protein B | - |
| N5934_RS02960 (N5934_02960) | 534531..534917 | + | 387 | WP_015570870.1 | pyrimidine utilization protein C | - |
| N5934_RS02965 (N5934_02965) | 534925..535725 | + | 801 | WP_110870841.1 | pyrimidine utilization protein D | - |
| N5934_RS02970 (N5934_02970) | 535735..536325 | + | 591 | WP_110870843.1 | malonic semialdehyde reductase | - |
| N5934_RS02975 (N5934_02975) | 536338..536829 | + | 492 | WP_110870845.1 | pyrimidine utilization flavin reductase protein F | - |
| N5934_RS02980 (N5934_02980) | 536851..538173 | + | 1323 | WP_047717623.1 | pyrimidine utilization transport protein G | - |
| N5934_RS02985 (N5934_02985) | 538232..538753 | - | 522 | WP_110870847.1 | GNAT family N-acetyltransferase | Toxin |
| N5934_RS02990 (N5934_02990) | 538760..539029 | - | 270 | WP_015570876.1 | DUF1778 domain-containing protein | Antitoxin |
| N5934_RS02995 (N5934_02995) | 539103..540008 | - | 906 | WP_032653183.1 | DMT family transporter | - |
| N5934_RS03000 (N5934_03000) | 540125..540295 | - | 171 | WP_001273664.1 | general stress protein | - |
| N5934_RS03005 (N5934_03005) | 540687..541283 | + | 597 | WP_006809323.1 | NAD(P)H:quinone oxidoreductase | - |
| N5934_RS03010 (N5934_03010) | 541302..541529 | + | 228 | WP_006809324.1 | YccJ family protein | - |
| N5934_RS03015 (N5934_03015) | 541562..542803 | - | 1242 | WP_047729185.1 | bifunctional glucose-1-phosphatase/inositol phosphatase | - |
| N5934_RS03020 (N5934_03020) | 542956..543051 | + | 96 | Protein_598 | transcriptional regulator | - |
| N5934_RS03025 (N5934_03025) | 543130..543489 | - | 360 | WP_017384779.1 | helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 174 a.a. Molecular weight: 19463.27 Da Isoelectric Point: 7.4318
>T259012 WP_110870847.1 NZ_CP104691:c538753-538232 [Enterobacter hormaechei]
VANLTIEMLSEGTDYDFGDFDCGEPSLNAFLTEHLIRQHGGRILRGYLLKERDHPRVLGYYTLSGSCFEKAMLPSKIQQR
RIPYSNVPSVTLGRLAVHKELQGNEWGTTLVTHAMRVVYLASQAVGVHGIFVDALNERAKRFYLKLGFIPLAGENSSSLF
FPTQSIERLFEQA
VANLTIEMLSEGTDYDFGDFDCGEPSLNAFLTEHLIRQHGGRILRGYLLKERDHPRVLGYYTLSGSCFEKAMLPSKIQQR
RIPYSNVPSVTLGRLAVHKELQGNEWGTTLVTHAMRVVYLASQAVGVHGIFVDALNERAKRFYLKLGFIPLAGENSSSLF
FPTQSIERLFEQA
Download Length: 522 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|