Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 4545181..4545797 | Replicon | chromosome |
| Accession | NZ_CP104689 | ||
| Organism | Enterobacter hormaechei strain 2020CK-00376 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | N5929_RS21670 | Protein ID | WP_045327153.1 |
| Coordinates | 4545181..4545552 (-) | Length | 124 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A6G4MTK3 |
| Locus tag | N5929_RS21675 | Protein ID | WP_015569912.1 |
| Coordinates | 4545555..4545797 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5929_RS21655 (N5929_14185) | 4542681..4543583 | + | 903 | WP_014072386.1 | formate dehydrogenase subunit beta | - |
| N5929_RS21660 (N5929_14180) | 4543580..4544215 | + | 636 | WP_003861958.1 | formate dehydrogenase cytochrome b556 subunit | - |
| N5929_RS21665 (N5929_14175) | 4544212..4545141 | + | 930 | WP_003861956.1 | formate dehydrogenase accessory protein FdhE | - |
| N5929_RS21670 (N5929_14170) | 4545181..4545552 | - | 372 | WP_045327153.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| N5929_RS21675 (N5929_14165) | 4545555..4545797 | - | 243 | WP_015569912.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| N5929_RS21680 (N5929_14160) | 4545996..4546916 | + | 921 | WP_023295638.1 | alpha/beta hydrolase | - |
| N5929_RS21685 (N5929_14155) | 4546925..4547866 | - | 942 | WP_015569910.1 | fatty acid biosynthesis protein FabY | - |
| N5929_RS21690 (N5929_14150) | 4547911..4548348 | - | 438 | WP_015569909.1 | D-aminoacyl-tRNA deacylase | - |
| N5929_RS21695 (N5929_14145) | 4548345..4549226 | - | 882 | WP_003861949.1 | virulence factor BrkB family protein | - |
| N5929_RS21700 (N5929_14140) | 4549220..4549819 | - | 600 | WP_003861947.1 | glucose-1-phosphatase | - |
| N5929_RS21705 (N5929_14135) | 4549938..4550738 | - | 801 | WP_003861944.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13697.77 Da Isoelectric Point: 6.4882
>T259011 WP_045327153.1 NZ_CP104689:c4545552-4545181 [Enterobacter hormaechei]
MEHMAVFDTNILIDLFNNRVEAADAIEHTASHRAISLITWMEVMVGARRHGHEAKTAAVMGAFEIIDVSRDIAERSVSLR
EKHGMKLPDAIILATAQSRKCPLISRNTKDFAGIDEVLTPYQV
MEHMAVFDTNILIDLFNNRVEAADAIEHTASHRAISLITWMEVMVGARRHGHEAKTAAVMGAFEIIDVSRDIAERSVSLR
EKHGMKLPDAIILATAQSRKCPLISRNTKDFAGIDEVLTPYQV
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|