Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 3655281..3655938 | Replicon | chromosome |
| Accession | NZ_CP104689 | ||
| Organism | Enterobacter hormaechei strain 2020CK-00376 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A179PSF7 |
| Locus tag | N5929_RS17400 | Protein ID | WP_017382887.1 |
| Coordinates | 3655281..3655691 (-) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | G8LDB7 |
| Locus tag | N5929_RS17405 | Protein ID | WP_003863437.1 |
| Coordinates | 3655672..3655938 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5929_RS17380 (N5929_18485) | 3651279..3653012 | - | 1734 | WP_023304383.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| N5929_RS17385 (N5929_18480) | 3653018..3653731 | - | 714 | WP_023295380.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| N5929_RS17390 (N5929_18475) | 3653760..3654656 | - | 897 | WP_003863442.1 | site-specific tyrosine recombinase XerD | - |
| N5929_RS17395 (N5929_18470) | 3654758..3655279 | + | 522 | WP_015571793.1 | flavodoxin FldB | - |
| N5929_RS17400 (N5929_18465) | 3655281..3655691 | - | 411 | WP_017382887.1 | protein YgfX | Toxin |
| N5929_RS17405 (N5929_18460) | 3655672..3655938 | - | 267 | WP_003863437.1 | FAD assembly factor SdhE | Antitoxin |
| N5929_RS17410 (N5929_18455) | 3656233..3657213 | + | 981 | WP_261666021.1 | tRNA-modifying protein YgfZ | - |
| N5929_RS17415 (N5929_18450) | 3657325..3657984 | - | 660 | WP_003863433.1 | hemolysin III family protein | - |
| N5929_RS17420 (N5929_18445) | 3658251..3658982 | + | 732 | WP_015571796.1 | MurR/RpiR family transcriptional regulator | - |
| N5929_RS17425 (N5929_18440) | 3659099..3660532 | + | 1434 | WP_023295383.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16321.21 Da Isoelectric Point: 11.4775
>T259010 WP_017382887.1 NZ_CP104689:c3655691-3655281 [Enterobacter hormaechei]
VVLWQSDLRVSWRSQWMSLLLHGLVAALVLLVPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWEMMGTPWMLNTGMMLRLRRVEDNRRQHLWLAADSMDPAEWRDLRRLIVQQPTQE
VVLWQSDLRVSWRSQWMSLLLHGLVAALVLLVPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWEMMGTPWMLNTGMMLRLRRVEDNRRQHLWLAADSMDPAEWRDLRRLIVQQPTQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A179PSF7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A837F8P5 |