Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
| Location | 621070..621646 | Replicon | chromosome |
| Accession | NZ_CP104689 | ||
| Organism | Enterobacter hormaechei strain 2020CK-00376 | ||
Toxin (Protein)
| Gene name | shpA | Uniprot ID | A0A800YKM1 |
| Locus tag | N5929_RS02955 | Protein ID | WP_015572580.1 |
| Coordinates | 621070..621357 (+) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | shpB | Uniprot ID | A0A801DSF4 |
| Locus tag | N5929_RS02960 | Protein ID | WP_017694570.1 |
| Coordinates | 621344..621646 (+) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5929_RS02930 (N5929_10825) | 616163..616882 | + | 720 | WP_023303034.1 | winged helix-turn-helix domain-containing protein | - |
| N5929_RS02935 (N5929_10820) | 617032..617502 | + | 471 | WP_023303035.1 | MarR family transcriptional regulator | - |
| N5929_RS02940 (N5929_10815) | 617499..618566 | + | 1068 | WP_026080654.1 | HlyD family secretion protein | - |
| N5929_RS02945 (N5929_10810) | 618556..619632 | + | 1077 | WP_015572578.1 | DUF2955 domain-containing protein | - |
| N5929_RS02950 (N5929_10805) | 619629..620900 | - | 1272 | WP_015572579.1 | DUF445 domain-containing protein | - |
| N5929_RS02955 (N5929_10800) | 621070..621357 | + | 288 | WP_015572580.1 | BrnT family toxin | Toxin |
| N5929_RS02960 (N5929_10795) | 621344..621646 | + | 303 | WP_017694570.1 | BrnA antitoxin family protein | Antitoxin |
| N5929_RS02965 (N5929_10790) | 621675..622313 | - | 639 | WP_015572581.1 | LysE family translocator | - |
| N5929_RS02970 (N5929_10785) | 622352..623104 | - | 753 | WP_015572582.1 | AraC family transcriptional regulator | - |
| N5929_RS02975 (N5929_10780) | 623258..624628 | + | 1371 | WP_017694568.1 | NAD-dependent succinate-semialdehyde dehydrogenase | - |
| N5929_RS02980 (N5929_10775) | 624806..625351 | - | 546 | WP_006810254.1 | YfaZ family outer membrane protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11296.81 Da Isoelectric Point: 7.3587
>T259003 WP_015572580.1 NZ_CP104689:621070-621357 [Enterobacter hormaechei]
MPIEYEWDSNKAKSNLQKHAIRFEDAVLVFDDPCHLSVQDRYENGEFRWQTIGLVQGVIVILVAHTVRFESGDEIIRIIS
ARKADRKERRRYEHR
MPIEYEWDSNKAKSNLQKHAIRFEDAVLVFDDPCHLSVQDRYENGEFRWQTIGLVQGVIVILVAHTVRFESGDEIIRIIS
ARKADRKERRRYEHR
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|