Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /RES-TIGR02293 |
| Location | 32852..33762 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP104683 | ||
| Organism | Escherichia coli strain 2022CK-00450 | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | A0A663AYG0 |
| Locus tag | N5922_RS25325 | Protein ID | WP_004026354.1 |
| Coordinates | 32852..33322 (-) | Length | 157 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | A0A2J4RLY9 |
| Locus tag | N5922_RS25330 | Protein ID | WP_004181895.1 |
| Coordinates | 33319..33762 (-) | Length | 148 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5922_RS25285 (N5922_25280) | 28196..28900 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| N5922_RS25290 (N5922_25285) | 29284..29775 | + | 492 | WP_004206662.1 | hypothetical protein | - |
| N5922_RS25295 (N5922_25290) | 29836..30039 | + | 204 | WP_004213596.1 | HHA domain-containing protein | - |
| N5922_RS25300 (N5922_25295) | 30053..30274 | + | 222 | WP_016237028.1 | hypothetical protein | - |
| N5922_RS25305 (N5922_25300) | 30296..31135 | + | 840 | Protein_36 | IS5 family transposase | - |
| N5922_RS25310 (N5922_25305) | 31135..31440 | + | 306 | Protein_37 | integrase core domain-containing protein | - |
| N5922_RS25315 (N5922_25310) | 31391..31783 | - | 393 | Protein_38 | transposase | - |
| N5922_RS25320 (N5922_25315) | 32482..32742 | + | 261 | WP_004026352.1 | hypothetical protein | - |
| N5922_RS25325 (N5922_25320) | 32852..33322 | - | 471 | WP_004026354.1 | RES family NAD+ phosphorylase | Toxin |
| N5922_RS25330 (N5922_25325) | 33319..33762 | - | 444 | WP_004181895.1 | DUF2384 domain-containing protein | Antitoxin |
| N5922_RS25335 (N5922_25330) | 33863..35134 | - | 1272 | WP_004181894.1 | translesion error-prone DNA polymerase V subunit UmuC | - |
| N5922_RS25340 (N5922_25335) | 35134..35502 | - | 369 | WP_042014650.1 | translesion error-prone DNA polymerase V autoproteolytic subunit | - |
| N5922_RS25345 (N5922_25340) | 35595..36575 | - | 981 | WP_103284490.1 | IS5-like element ISKpn26 family transposase | - |
| N5922_RS25350 (N5922_25345) | 36601..37563 | + | 963 | WP_261588837.1 | IS5 family transposase | - |
| N5922_RS25355 (N5922_25350) | 37789..38486 | + | 698 | WP_103215986.1 | IS1-like element IS1A family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..122304 | 122304 | |
| - | inside | IScluster/Tn | - | - | 18717..42312 | 23595 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 157 a.a. Molecular weight: 17515.79 Da Isoelectric Point: 4.6155
>T259001 WP_004026354.1 NZ_CP104683:c33322-32852 [Escherichia coli]
VILYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPGNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIPFRFDSRLKPDRK
VILYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPGNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIPFRFDSRLKPDRK
Download Length: 471 bp
Antitoxin
Download Length: 148 a.a. Molecular weight: 16536.87 Da Isoelectric Point: 10.3013
>AT259001 WP_004181895.1 NZ_CP104683:c33762-33319 [Escherichia coli]
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVVNRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDREAAQKWLNEPNRALSWKVPADLMASETGAYEVIKLITRLEHGVYS
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVVNRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDREAAQKWLNEPNRALSWKVPADLMASETGAYEVIKLITRLEHGVYS
Download Length: 444 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A663AYG0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J4RLY9 |