258998

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 4234464..4234991 Replicon chromosome
Accession NZ_CP104681
Organism Escherichia coli strain 2022CK-00450

Toxin (Protein)


Gene name relE Uniprot ID A0A7H9NEL1
Locus tag N5922_RS20865 Protein ID WP_023220446.1
Coordinates 4234464..4234739 (-) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag N5922_RS20870 Protein ID WP_261587084.1
Coordinates 4234743..4234991 (-) Length 83 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5922_RS20835 (4229821) 4229821..4230927 + 1107 WP_029403685.1 N-acetylneuraminate epimerase -
N5922_RS20840 (4230992) 4230992..4231972 + 981 WP_000338801.1 sialate O-acetylesterase -
N5922_RS20845 (4231980) 4231980..4232630 - 651 WP_001037977.1 HNH endonuclease -
N5922_RS20850 (4232767) 4232767..4232910 + 144 Protein_4084 HNH endonuclease -
N5922_RS20855 (4233009) 4233009..4233194 + 186 WP_000066585.1 hypothetical protein -
N5922_RS20860 (4233552) 4233552..4234349 - 798 WP_053919267.1 helix-turn-helix transcriptional regulator -
N5922_RS20865 (4234464) 4234464..4234739 - 276 WP_023220446.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
N5922_RS20870 (4234743) 4234743..4234991 - 249 WP_261587084.1 ribbon-helix-helix domain-containing protein Antitoxin
N5922_RS20875 (4235067) 4235067..4235909 - 843 WP_048963608.1 DUF4942 domain-containing protein -
N5922_RS20880 (4236022) 4236022..4236372 - 351 WP_053087800.1 DUF5983 family protein -
N5922_RS20885 (4236399) 4236399..4236575 - 177 Protein_4091 DUF5983 family protein -
N5922_RS20890 (4236566) 4236566..4236940 - 375 WP_023220442.1 TA system toxin CbtA family protein -
N5922_RS20895 (4236986) 4236986..4237633 - 648 WP_048963607.1 hypothetical protein -
N5922_RS20900 (4237630) 4237630..4238001 - 372 WP_048963606.1 type IV toxin-antitoxin system YeeU family antitoxin -
N5922_RS20905 (4237973) 4237973..4238341 - 369 WP_023220439.1 type IV toxin-antitoxin system YeeU family antitoxin -
N5922_RS20910 (4238359) 4238359..4238580 - 222 WP_048963605.1 DUF987 family protein -
N5922_RS20915 (4238577) 4238577..4238867 - 291 WP_048963604.1 hypothetical protein -
N5922_RS20920 (4238883) 4238883..4239362 - 480 WP_048963603.1 DNA repair protein RadC -
N5922_RS20925 (4239373) 4239373..4239813 - 441 WP_261588726.1 antirestriction protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - fimB 4227027..4259439 32412


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(9-40)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 11046.41 Da        Isoelectric Point: 5.8988

>T258998 WP_023220446.1 NZ_CP104681:c4234739-4234464 [Escherichia coli]
MEIYWTFKAQDDLERIYRFALQYSRKHADDILDRLITGCAGLTAHPAIGVHQTRYEPREVRKVLFDDYEVHYEIRDNDIH
IVDLWHTKEER

Download         Length: 276 bp

Antitoxin


Download         Length: 83 a.a.        Molecular weight: 9030.45 Da        Isoelectric Point: 7.1666

>AT258998 WP_261587084.1 NZ_CP104681:c4234991-4234743 [Escherichia coli]
MGSLTKQTISAQIPVELAAAVENLAIELDRSKSWIIKEALTCMLAERERRHQSIQAGLADVDAGRVVSHLDMVDFANRLK
KA

Download         Length: 249 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7H9NEL1

Antitoxin

Source ID Structure

References