Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yafW-ykfI/CbtA-CbeA
Location 3790709..3791388 Replicon chromosome
Accession NZ_CP104681
Organism Escherichia coli strain 2022CK-00450

Toxin (Protein)


Gene name ykfI Uniprot ID S1FHS4
Locus tag N5922_RS18590 Protein ID WP_000854680.1
Coordinates 3791047..3791388 (+) Length 114 a.a.

Antitoxin (Protein)


Gene name yafW Uniprot ID S1EWR7
Locus tag N5922_RS18585 Protein ID WP_000070396.1
Coordinates 3790709..3791026 (+) Length 106 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5922_RS18540 (3786147) 3786147..3786968 + 822 WP_000197387.1 DUF932 domain-containing protein -
N5922_RS18545 (3787185) 3787185..3787886 + 702 WP_000189411.1 WYL domain-containing protein -
N5922_RS18550 (3787927) 3787927..3788163 + 237 WP_001144031.1 protein YpjK -
N5922_RS18555 (3788163) 3788163..3788606 + 444 WP_000649865.1 hypothetical protein -
N5922_RS18560 (3788629) 3788629..3789096 + 468 WP_001385283.1 protein YkfB -
N5922_RS18565 (3789173) 3789173..3789412 + 240 WP_000194654.1 DUF905 family protein -
N5922_RS18570 (3789510) 3789510..3789968 + 459 WP_000211838.1 antirestriction protein -
N5922_RS18575 (3789984) 3789984..3790460 + 477 WP_000811693.1 RadC family protein -
N5922_RS18580 (3790469) 3790469..3790690 + 222 WP_000691994.1 DUF987 domain-containing protein -
N5922_RS18585 (3790709) 3790709..3791026 + 318 WP_000070396.1 type IV toxin-antitoxin system antitoxin YafW Antitoxin
N5922_RS18590 (3791047) 3791047..3791388 + 342 WP_000854680.1 type IV toxin-antitoxin system toxin YkfI Toxin
N5922_RS18595 (3792054) 3792054..3792263 + 210 Protein_3644 integrase core domain-containing protein -
N5922_RS18600 (3792305) 3792305..3793048 - 744 WP_089584665.1 AraC family transcriptional regulator -
N5922_RS18605 (3793449) 3793449..3794429 - 981 WP_000019441.1 IS5-like element ISKpn26 family transposase -
N5922_RS18610 (3794500) 3794500..3794931 + 432 Protein_3647 phage tail protein -
N5922_RS18615 (3794931) 3794931..3795524 + 594 WP_000805549.1 tail fiber assembly protein -
N5922_RS18620 (3795496) 3795496..3795933 - 438 WP_032173814.1 tail assembly chaperone -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 3786147..3833408 47261


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(6-104)


Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 12892.95 Da        Isoelectric Point: 9.6543

>T258994 WP_000854680.1 NZ_CP104681:3791047-3791388 [Escherichia coli]
MKTLPATTQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR

Download         Length: 342 bp

Antitoxin


Download         Length: 106 a.a.        Molecular weight: 11982.62 Da        Isoelectric Point: 7.0270

>AT258994 WP_000070396.1 NZ_CP104681:3790709-3791026 [Escherichia coli]
MSNPTRGLQREITLRLGARLVQEGNRLHYLADRASITGKFSDIECRKLDETFPHFIRQMESMLTTGELSPHHAHCVTLYH
NDLTCEADTLGSCGYVYIAIYPTQR

Download         Length: 318 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1FHS4

Antitoxin

Source ID Structure
AlphaFold DB S1EWR7

References