Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
Location | 3207474..3208179 | Replicon | chromosome |
Accession | NZ_CP104681 | ||
Organism | Escherichia coli strain 2022CK-00450 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1F406 |
Locus tag | N5922_RS15805 | Protein ID | WP_000539521.1 |
Coordinates | 3207474..3207860 (+) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | N5922_RS15810 | Protein ID | WP_001280945.1 |
Coordinates | 3207850..3208179 (+) | Length | 110 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5922_RS15785 (3203478) | 3203478..3204104 | + | 627 | WP_016241992.1 | glutathione S-transferase GstB | - |
N5922_RS15790 (3204101) | 3204101..3205216 | - | 1116 | WP_000555031.1 | aldose sugar dehydrogenase YliI | - |
N5922_RS15795 (3205327) | 3205327..3205710 | - | 384 | WP_000497137.1 | biofilm formation regulator BssR | - |
N5922_RS15800 (3205923) | 3205923..3207248 | + | 1326 | WP_000049367.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
N5922_RS15805 (3207474) | 3207474..3207860 | + | 387 | WP_000539521.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N5922_RS15810 (3207850) | 3207850..3208179 | + | 330 | WP_001280945.1 | DNA-binding transcriptional regulator | Antitoxin |
N5922_RS15815 (3208249) | 3208249..3209577 | - | 1329 | WP_000086877.1 | GGDEF domain-containing protein | - |
N5922_RS15820 (3209585) | 3209585..3211162 | - | 1578 | Protein_3105 | cyclic diguanylate phosphodiesterase | - |
N5922_RS15825 (3211217) | 3211217..3211914 | + | 698 | WP_103215986.1 | IS1-like element IS1A family transposase | - |
N5922_RS15830 (3211937) | 3211937..3212848 | - | 912 | WP_001236042.1 | glutathione ABC transporter permease GsiD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14293.45 Da Isoelectric Point: 9.9296
>T258992 WP_000539521.1 NZ_CP104681:3207474-3207860 [Escherichia coli]
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|