Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2548061..2548699 | Replicon | chromosome |
Accession | NZ_CP104681 | ||
Organism | Escherichia coli strain 2022CK-00450 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | N5922_RS12415 | Protein ID | WP_000813794.1 |
Coordinates | 2548523..2548699 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | N5922_RS12410 | Protein ID | WP_001270286.1 |
Coordinates | 2548061..2548477 (-) | Length | 139 a.a. |
Genomic Context
Location: 2548921..2549151 (231 bp)
Type: Others
Protein ID: WP_000494244.1
Type: Others
Protein ID: WP_000494244.1
Location: 2551905..2553080 (1176 bp)
Type: Others
Protein ID: WP_016242090.1
Type: Others
Protein ID: WP_016242090.1
Location: 2543213..2544154 (942 bp)
Type: Others
Protein ID: WP_001251313.1
Type: Others
Protein ID: WP_001251313.1
Location: 2544155..2545168 (1014 bp)
Type: Others
Protein ID: WP_000220399.1
Type: Others
Protein ID: WP_000220399.1
Location: 2545186..2546331 (1146 bp)
Type: Others
Protein ID: WP_000047424.1
Type: Others
Protein ID: WP_000047424.1
Location: 2546576..2547982 (1407 bp)
Type: Others
Protein ID: WP_000760626.1
Type: Others
Protein ID: WP_000760626.1
Location: 2548061..2548477 (417 bp)
Type: Antitoxin
Protein ID: WP_001270286.1
Type: Antitoxin
Protein ID: WP_001270286.1
Location: 2548523..2548699 (177 bp)
Type: Toxin
Protein ID: WP_000813794.1
Type: Toxin
Protein ID: WP_000813794.1
Location: 2549243..2551204 (1962 bp)
Type: Others
Protein ID: WP_001301045.1
Type: Others
Protein ID: WP_001301045.1
Location: 2551277..2551813 (537 bp)
Type: Others
Protein ID: WP_000429155.1
Type: Others
Protein ID: WP_000429155.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5922_RS12390 (2543213) | 2543213..2544154 | - | 942 | WP_001251313.1 | ABC transporter permease | - |
N5922_RS12395 (2544155) | 2544155..2545168 | - | 1014 | WP_000220399.1 | ABC transporter ATP-binding protein | - |
N5922_RS12400 (2545186) | 2545186..2546331 | - | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
N5922_RS12405 (2546576) | 2546576..2547982 | - | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
N5922_RS12410 (2548061) | 2548061..2548477 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
N5922_RS12415 (2548523) | 2548523..2548699 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
N5922_RS12420 (2548921) | 2548921..2549151 | + | 231 | WP_000494244.1 | YncJ family protein | - |
N5922_RS12425 (2549243) | 2549243..2551204 | - | 1962 | WP_001301045.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
N5922_RS12430 (2551277) | 2551277..2551813 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
N5922_RS12435 (2551905) | 2551905..2553080 | + | 1176 | WP_016242090.1 | BenE family transporter YdcO | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T258991 WP_000813794.1 NZ_CP104681:c2548699-2548523 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT258991 WP_001270286.1 NZ_CP104681:c2548477-2548061 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
PDB | 6HPB |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |