Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
| Location | 1120432..1121015 | Replicon | chromosome |
| Accession | NZ_CP104681 | ||
| Organism | Escherichia coli strain 2022CK-00450 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | S1EZP4 |
| Locus tag | N5922_RS05470 | Protein ID | WP_000254738.1 |
| Coordinates | 1120680..1121015 (+) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | S1P3W5 |
| Locus tag | N5922_RS05465 | Protein ID | WP_000581937.1 |
| Coordinates | 1120432..1120680 (+) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5922_RS05455 (1116771) | 1116771..1118072 | + | 1302 | WP_000046790.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
| N5922_RS05460 (1118120) | 1118120..1120354 | + | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
| N5922_RS05465 (1120432) | 1120432..1120680 | + | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| N5922_RS05470 (1120680) | 1120680..1121015 | + | 336 | WP_000254738.1 | endoribonuclease MazF | Toxin |
| N5922_RS05475 (1121086) | 1121086..1121877 | + | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
| N5922_RS05480 (1122105) | 1122105..1123742 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
| N5922_RS05485 (1123830) | 1123830..1125128 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
| N5922_RS05490 (1125188) | 1125188..1125889 | - | 702 | Protein_1078 | YgcG family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12098.04 Da Isoelectric Point: 8.2618
>T258984 WP_000254738.1 NZ_CP104681:1120680-1121015 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|