Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 28968..29611 Replicon plasmid unnamed2
Accession NZ_CP104680
Organism Klebsiella pneumoniae strain 2021CK-00608

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag N5933_RS27700 Protein ID WP_001044770.1
Coordinates 28968..29384 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag N5933_RS27705 Protein ID WP_001261282.1
Coordinates 29381..29611 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5933_RS27670 (N5933_27675) 24318..25106 + 789 WP_001206315.1 ANT(3'')-Ia family aminoglycoside nucleotidyltransferase AadA1 -
N5933_RS27675 (N5933_27680) 25166..25990 + 825 Protein_30 OXA-9 family oxacillin-hydrolyzing class D beta-lactamase -
N5933_RS27680 (N5933_27685) 26190..26507 + 318 Protein_31 recombinase family protein -
N5933_RS27685 (N5933_27690) 26690..27436 + 747 Protein_32 class A beta-lactamase -
N5933_RS27695 (N5933_27700) 28205..28894 - 690 Protein_34 ATP-binding protein -
N5933_RS27700 (N5933_27705) 28968..29384 - 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
N5933_RS27705 (N5933_27710) 29381..29611 - 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
N5933_RS27710 (N5933_27715) 29568..30027 + 460 Protein_37 hypothetical protein -
N5933_RS27715 (N5933_27720) 30514..30822 + 309 WP_004152336.1 hypothetical protein -
N5933_RS27720 (N5933_27725) 30850..31179 + 330 WP_004152337.1 hypothetical protein -
N5933_RS27725 (N5933_27730) 31205..31603 + 399 WP_004171440.1 hypothetical protein -
N5933_RS27730 (N5933_27735) 31610..31942 + 333 WP_004152339.1 hypothetical protein -
N5933_RS27735 (N5933_27740) 31942..32724 + 783 WP_004152340.1 site-specific integrase -
N5933_RS27740 (N5933_27745) 33938..34411 - 474 WP_004152341.1 YkgJ family cysteine cluster protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaNDM-1 / aph(3')-VI / qnrS1 / blaCTX-M-15 / aac(6')-Ib / ant(3'')-Ia / blaOXA-9 / blaTEM-1B - 1..112409 112409
- flank IS/Tn - - 34531..35799 1268


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T258978 WP_001044770.1 NZ_CP104680:c29384-28968 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT258978 WP_001261282.1 NZ_CP104680:c29611-29381 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References