Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4872164..4872680 | Replicon | chromosome |
Accession | NZ_CP104678 | ||
Organism | Klebsiella pneumoniae strain 2021CK-00608 |
Toxin (Protein)
Gene name | relE | Uniprot ID | R4YAY3 |
Locus tag | N5933_RS23790 | Protein ID | WP_004178374.1 |
Coordinates | 4872164..4872448 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | N5933_RS23795 | Protein ID | WP_002886901.1 |
Coordinates | 4872438..4872680 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5933_RS23765 (4867648) | 4867648..4867911 | - | 264 | WP_020324507.1 | PTS system, lactose/cellobiose-specific IIB subunit | - |
N5933_RS23770 (4868041) | 4868041..4868214 | + | 174 | WP_032408826.1 | hypothetical protein | - |
N5933_RS23775 (4868217) | 4868217..4868960 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
N5933_RS23780 (4869317) | 4869317..4871455 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
N5933_RS23785 (4871696) | 4871696..4872160 | + | 465 | WP_004178375.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
N5933_RS23790 (4872164) | 4872164..4872448 | - | 285 | WP_004178374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N5933_RS23795 (4872438) | 4872438..4872680 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
N5933_RS23800 (4872758) | 4872758..4874668 | - | 1911 | WP_004178373.1 | PRD domain-containing protein | - |
N5933_RS23805 (4874691) | 4874691..4875845 | - | 1155 | WP_004178372.1 | lactonase family protein | - |
N5933_RS23810 (4875912) | 4875912..4876652 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11155.97 Da Isoelectric Point: 10.3787
>T258972 WP_004178374.1 NZ_CP104678:c4872448-4872164 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A6THG1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |