Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4090770..4091389 Replicon chromosome
Accession NZ_CP104678
Organism Klebsiella pneumoniae strain 2021CK-00608

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag N5933_RS20095 Protein ID WP_002892050.1
Coordinates 4091171..4091389 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag N5933_RS20090 Protein ID WP_002892066.1
Coordinates 4090770..4091144 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5933_RS20080 (4085922) 4085922..4087115 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
N5933_RS20085 (4087138) 4087138..4090284 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
N5933_RS20090 (4090770) 4090770..4091144 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
N5933_RS20095 (4091171) 4091171..4091389 + 219 WP_002892050.1 HHA domain-containing protein Toxin
N5933_RS20100 (4091548) 4091548..4092114 + 567 WP_002892030.1 maltose O-acetyltransferase -
N5933_RS20105 (4092086) 4092086..4092226 - 141 WP_004147370.1 hypothetical protein -
N5933_RS20110 (4092247) 4092247..4092717 + 471 WP_002892026.1 YlaC family protein -
N5933_RS20115 (4092692) 4092692..4094143 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
N5933_RS20120 (4094244) 4094244..4094942 + 699 WP_002892021.1 GNAT family protein -
N5933_RS20125 (4094939) 4094939..4095079 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
N5933_RS20130 (4095079) 4095079..4095342 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T258969 WP_002892050.1 NZ_CP104678:4091171-4091389 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT258969 WP_002892066.1 NZ_CP104678:4090770-4091144 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References