Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 4090770..4091389 | Replicon | chromosome |
| Accession | NZ_CP104678 | ||
| Organism | Klebsiella pneumoniae strain 2021CK-00608 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | N5933_RS20095 | Protein ID | WP_002892050.1 |
| Coordinates | 4091171..4091389 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | J2DPF6 |
| Locus tag | N5933_RS20090 | Protein ID | WP_002892066.1 |
| Coordinates | 4090770..4091144 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5933_RS20080 (4085922) | 4085922..4087115 | + | 1194 | WP_002892072.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| N5933_RS20085 (4087138) | 4087138..4090284 | + | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| N5933_RS20090 (4090770) | 4090770..4091144 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
| N5933_RS20095 (4091171) | 4091171..4091389 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
| N5933_RS20100 (4091548) | 4091548..4092114 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
| N5933_RS20105 (4092086) | 4092086..4092226 | - | 141 | WP_004147370.1 | hypothetical protein | - |
| N5933_RS20110 (4092247) | 4092247..4092717 | + | 471 | WP_002892026.1 | YlaC family protein | - |
| N5933_RS20115 (4092692) | 4092692..4094143 | - | 1452 | WP_002892023.1 | PLP-dependent aminotransferase family protein | - |
| N5933_RS20120 (4094244) | 4094244..4094942 | + | 699 | WP_002892021.1 | GNAT family protein | - |
| N5933_RS20125 (4094939) | 4094939..4095079 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
| N5933_RS20130 (4095079) | 4095079..4095342 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T258969 WP_002892050.1 NZ_CP104678:4091171-4091389 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT258969 WP_002892066.1 NZ_CP104678:4090770-4091144 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GJ93 |