Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 845371..846028 | Replicon | chromosome |
| Accession | NZ_CP104678 | ||
| Organism | Klebsiella pneumoniae strain 2021CK-00608 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | W8UCT0 |
| Locus tag | N5933_RS04180 | Protein ID | WP_002916310.1 |
| Coordinates | 845618..846028 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | W8UQ37 |
| Locus tag | N5933_RS04175 | Protein ID | WP_002916312.1 |
| Coordinates | 845371..845637 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5933_RS04150 (840527) | 840527..841960 | - | 1434 | WP_004185559.1 | 6-phospho-beta-glucosidase BglA | - |
| N5933_RS04155 (842079) | 842079..842807 | - | 729 | WP_002916321.1 | MurR/RpiR family transcriptional regulator | - |
| N5933_RS04160 (842857) | 842857..843168 | + | 312 | WP_004144734.1 | N(4)-acetylcytidine aminohydrolase | - |
| N5933_RS04165 (843332) | 843332..843991 | + | 660 | WP_002916317.1 | hemolysin III family protein | - |
| N5933_RS04170 (844142) | 844142..845125 | - | 984 | WP_020324927.1 | tRNA-modifying protein YgfZ | - |
| N5933_RS04175 (845371) | 845371..845637 | + | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
| N5933_RS04180 (845618) | 845618..846028 | + | 411 | WP_002916310.1 | protein YgfX | Toxin |
| N5933_RS04185 (846035) | 846035..846556 | - | 522 | WP_004144730.1 | flavodoxin FldB | - |
| N5933_RS04190 (846657) | 846657..847553 | + | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
| N5933_RS04195 (847576) | 847576..848289 | + | 714 | WP_002916301.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| N5933_RS04200 (848295) | 848295..850028 | + | 1734 | WP_004149758.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16049.85 Da Isoelectric Point: 11.4778
>T258962 WP_002916310.1 NZ_CP104678:845618-846028 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GSW7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GY41 |