Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
Location | 695455..696134 | Replicon | chromosome |
Accession | NZ_CP104678 | ||
Organism | Klebsiella pneumoniae strain 2021CK-00608 |
Toxin (Protein)
Gene name | ykfI | Uniprot ID | A0A0C7K7A4 |
Locus tag | N5933_RS03415 | Protein ID | WP_020324801.1 |
Coordinates | 695793..696134 (+) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | A0A0C7KEL2 |
Locus tag | N5933_RS03410 | Protein ID | WP_020324792.1 |
Coordinates | 695455..695772 (+) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5933_RS03385 (690669) | 690669..693821 | + | 3153 | WP_022631414.1 | AIDA repeat-containing protein | - |
N5933_RS03390 (693914) | 693914..694153 | + | 240 | WP_020324820.1 | DUF905 domain-containing protein | - |
N5933_RS03395 (694256) | 694256..694714 | + | 459 | WP_261658308.1 | antirestriction protein | - |
N5933_RS03400 (694730) | 694730..695206 | + | 477 | WP_020324797.1 | RadC family protein | - |
N5933_RS03405 (695215) | 695215..695442 | + | 228 | WP_020324796.1 | DUF987 domain-containing protein | - |
N5933_RS03410 (695455) | 695455..695772 | + | 318 | WP_020324792.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
N5933_RS03415 (695793) | 695793..696134 | + | 342 | WP_020324801.1 | TA system toxin CbtA family protein | Toxin |
N5933_RS03420 (696250) | 696250..697083 | + | 834 | WP_020324805.1 | DUF4942 domain-containing protein | - |
N5933_RS03430 (697386) | 697386..697892 | + | 507 | WP_002917636.1 | G/U mismatch-specific DNA glycosylase | - |
N5933_RS03435 (697992) | 697992..699833 | - | 1842 | WP_004174339.1 | RNA polymerase sigma factor RpoD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | fimA / fimI / fimC / fimD / fimD / fimF / fimG | 647513..697083 | 49570 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12818.91 Da Isoelectric Point: 9.1484
>T258961 WP_020324801.1 NZ_CP104678:695793-696134 [Klebsiella pneumoniae]
MKTLPAIISRAAKPCLSPVAVWQMLLTRLLEKHYGLTLNDTPFCDETVIQEHIDAGITLADAVNFLVEKYGLVRIDRNGF
VWQEQSPYLRAVDILRARQATGLLRQSRNNAIR
MKTLPAIISRAAKPCLSPVAVWQMLLTRLLEKHYGLTLNDTPFCDETVIQEHIDAGITLADAVNFLVEKYGLVRIDRNGF
VWQEQSPYLRAVDILRARQATGLLRQSRNNAIR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0C7K7A4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0C7KEL2 |