Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4214985..4215766 | Replicon | chromosome |
Accession | NZ_CP104677 | ||
Organism | Salmonella enterica strain PNUSAS036471 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | A0A0R9NZI3 |
Locus tag | N4534_RS20575 | Protein ID | WP_000625912.1 |
Coordinates | 4214985..4215476 (-) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | M7RNV8 |
Locus tag | N4534_RS20580 | Protein ID | WP_001110450.1 |
Coordinates | 4215473..4215766 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4534_RS20550 (4211867) | 4211867..4212697 | - | 831 | WP_001180236.1 | fimbria/pilus periplasmic chaperone | - |
N4534_RS20555 (4212899) | 4212899..4213174 | - | 276 | WP_001281414.1 | PapB/FocB family fimbrial expression transcriptional regulator | - |
N4534_RS20560 (4213735) | 4213735..4213878 | + | 144 | Protein_4019 | transposase | - |
N4534_RS20565 (4213895) | 4213895..4214241 | + | 347 | Protein_4020 | Rpn family recombination-promoting nuclease/putative transposase | - |
N4534_RS20570 (4214522) | 4214522..4214770 | - | 249 | Protein_4021 | IS481 family transposase | - |
N4534_RS20575 (4214985) | 4214985..4215476 | - | 492 | WP_000625912.1 | GNAT family N-acetyltransferase | Toxin |
N4534_RS20580 (4215473) | 4215473..4215766 | - | 294 | WP_001110450.1 | DUF1778 domain-containing protein | Antitoxin |
N4534_RS20585 (4216083) | 4216083..4216305 | + | 223 | Protein_4024 | hypothetical protein | - |
N4534_RS20590 (4216569) | 4216569..4217444 | + | 876 | WP_000921676.1 | AraC family transcriptional regulator | - |
N4534_RS20595 (4217441) | 4217441..4217728 | + | 288 | WP_001269916.1 | transcriptional regulator RtsB | - |
N4534_RS20600 (4217721) | 4217721..4217903 | - | 183 | WP_001670702.1 | ATP-binding cassette domain-containing protein | - |
N4534_RS20605 (4217923) | 4217923..4218022 | + | 100 | Protein_4028 | hypothetical protein | - |
N4534_RS20610 (4218136) | 4218136..4218270 | + | 135 | Protein_4029 | hypothetical protein | - |
N4534_RS20615 (4218565) | 4218565..4219470 | - | 906 | WP_129429071.1 | YjiK family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4208074..4217728 | 9654 | |
- | inside | Genomic island | - | - | 4208074..4217903 | 9829 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17606.43 Da Isoelectric Point: 7.7297
>T258957 WP_000625912.1 NZ_CP104677:c4215476-4214985 [Salmonella enterica]
MISSPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQTTGASRTFVCCGSDSSVLAYYSLASSAVTTNTAPGRFRRNMPDP
IPIVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
MISSPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQTTGASRTFVCCGSDSSVLAYYSLASSAVTTNTAPGRFRRNMPDP
IPIVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0R9NZI3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0R9PGG6 |