Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4097579..4098095 | Replicon | chromosome |
| Accession | NZ_CP104677 | ||
| Organism | Salmonella enterica strain PNUSAS036471 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | C0Q7A9 |
| Locus tag | N4534_RS19930 | Protein ID | WP_000220578.1 |
| Coordinates | 4097579..4097863 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | V7ISI8 |
| Locus tag | N4534_RS19935 | Protein ID | WP_000212724.1 |
| Coordinates | 4097853..4098095 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4534_RS19915 (4092791) | 4092791..4094443 | + | 1653 | WP_000155045.1 | alpha,alpha-phosphotrehalase | - |
| N4534_RS19920 (4094852) | 4094852..4096990 | + | 2139 | WP_000187825.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| N4534_RS19925 (4097111) | 4097111..4097575 | + | 465 | WP_001268864.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| N4534_RS19930 (4097579) | 4097579..4097863 | - | 285 | WP_000220578.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N4534_RS19935 (4097853) | 4097853..4098095 | - | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| N4534_RS19940 (4098173) | 4098173..4100086 | - | 1914 | WP_001212150.1 | BglG family transcription antiterminator | - |
| N4534_RS19945 (4100103) | 4100103..4100843 | - | 741 | WP_000779258.1 | KDGP aldolase family protein | - |
| N4534_RS19950 (4100840) | 4100840..4101958 | - | 1119 | WP_001139169.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
| N4534_RS19955 (4101942) | 4101942..4103075 | - | 1134 | WP_000459939.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10854.67 Da Isoelectric Point: 10.0482
>T258956 WP_000220578.1 NZ_CP104677:c4097863-4097579 [Salmonella enterica]
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3Z1E876 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5H5JRI5 |